KEGG   Homo sapiens (human): 51606Help
Entry
51606             CDS       T01001                                 

Gene name
ATP6V1H, MSTP042, NBP1, SFD, SFDalpha, SFDbeta, VMA13
Definition
ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H (EC:3.6.3.14)
Orthology
K02144  
V-type H+-transporting ATPase subunit H
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Lysosome
Phagosome
Synaptic vesicle cycle
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Tuberculosis
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    51606 (ATP6V1H)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    51606 (ATP6V1H)
   04142 Lysosome
    51606 (ATP6V1H)
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    51606 (ATP6V1H)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    51606 (ATP6V1H)
  Infectious diseases
   05110 Vibrio cholerae infection
    51606 (ATP6V1H)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    51606 (ATP6V1H)
   05152 Tuberculosis
    51606 (ATP6V1H)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q11.2
AA seq 483 aa AA seqDB search
MTKMDIRGAVDAAVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPE
EKQEMLQTEGSQCAKTFINLMTHICKEQTVQYILTMVDDMLQENHQRVSIFFDYARCSKN
TAWPYFLPMLNRQDPFTVHMAARIIAKLAAWGKELMEGSDLNYYFNWIKTQLSSQKLRGS
GVAVETGTVSSSDSSQYVQCVAGCLQLMLRVNEYRFAWVEADGVNCIMGVLSNKCGFQLQ
YQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEKVTRIILAAFRNFLEKSTERE
TRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELK
SGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAVAAHDVGEYVRH
YPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSEQPQTAA
ARS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaatggatatccgaggtgctgtggatgctgctgtccccaccaatattattgct
gccaaggctgcagaagttcgtgcaaacaaagtcaactggcaatcctatcttcagggacag
atgatttctgctgaagattgtgagtttattcagaggtttgaaatgaaacgaagccctgaa
gagaagcaagagatgcttcaaactgaaggcagccagtgtgctaaaacatttataaatctg
atgactcatatctgcaaagaacagaccgttcagtatatactaactatggtggatgatatg
ctgcaggaaaatcatcagcgtgttagcattttctttgactatgcaagatgtagcaagaac
actgcgtggccctactttctgccaatgttgaatcgccaggatcccttcactgttcatatg
gcagcaagaattattgccaagttagcagcttggggaaaagaactgatggaaggcagtgac
ttaaattactatttcaattggataaaaactcagctgagttcacagaaactgcgtggtagc
ggtgttgctgttgaaacaggaacagtctcttcaagtgatagttcgcagtatgtgcagtgc
gtggccgggtgtttgcagctgatgctccgggtcaatgagtaccgctttgcttgggtggaa
gcagatggggtaaattgcataatgggagtgttgagtaacaagtgtggctttcagctccag
tatcaaatgattttttcaatatggctcctggcattcagtcctcaaatgtgtgaacacctg
cggcgctataatatcattccagttctgtctgatatccttcaggagtctgtcaaagagaaa
gtaacaagaatcattcttgcagcatttcgtaactttttagaaaaatcaactgaaagagaa
actcgccaagaatatgccctggctatgattcagtgcaaagttctgaaacagttggagaac
ttggaacagcagaagtacgatgatgaagatatcagcgaagatatcaaatttcttttggaa
aaacttggagagagtgtccaggaccttagttcatttgatgaatacagttcagaacttaaa
tctggaaggttggaatggagtcctgtgcacaaatctgagaaattttggagagagaatgct
gtgaggttaaatgagaagaattatgaactcttgaaaatcttgacaaaacttttggaagtg
tcagatgatccccaagtcttagctgttgctgctcacgatgttggagaatatgtgcggcat
tatccacgaggcaaacgggtcatcgagcagctcggtgggaagcagctggtcatgaaccac
atgcatcatgaagaccagcaggtccgctataatgctctgctggccgtgcagaagctcatg
gtgcacaactgggaataccttggcaagcagctccagtccgagcagccccagaccgctgcc
gcccgaagctaa

DBGET integrated database retrieval system