KEGG   Homo sapiens (human): 51651Help
Entry
51651             CDS       T01001                                 

Gene name
PTRH2, BIT1, CFAP37, CGI-147, IMNEPD, PTH, PTH_2, PTH2
Definition
(RefSeq) peptidyl-tRNA hydrolase 2 (EC:3.1.1.29)
  KO
K04794  
peptidyl-tRNA hydrolase, PTH2 family [EC:3.1.1.29]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.29  aminoacyl-tRNA hydrolase
     51651 (PTRH2)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Release factors
   51651 (PTRH2)
 Prokaryotic Type
   51651 (PTRH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q23.1
AA seq 179 aa AA seqDB search
MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILG
DSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKA
PDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgccctccaaatccttggttatggaatatttggctcatcccagtacactcggcttggct
gttggagttgcttgtggcatgtgcctgggctggagccttcgagtatgctttgggatgctc
cccaaaagcaagacgagcaagacacacacagatactgaaagtgaagcaagcatcttggga
gacagcggggagtacaagatgattcttgtggttcgaaatgacttaaagatgggaaaaggg
aaagtggctgcccagtgctctcatgctgctgtttcagcctacaagcagattcaaagaaga
aatcctgaaatgctcaaacaatgggaatactgtggccagcccaaggtggtggtcaaagct
cctgatgaagaaaccctgattgcattattggcccatgcaaaaatgctgggactgactgta
agtttaattcaagatgctggacgtactcagattgcaccaggctctcaaactgtcctaggg
attgggccaggaccagcagacctaattgacaaagtcactggtcacctaaaactttactag

DBGET integrated database retrieval system