KEGG   Homo sapiens (human): 51652Help
Entry
51652             CDS       T01001                                 

Gene name
CHMP3, CGI-149, NEDF, VPS24
Definition
(RefSeq) charged multivesicular body protein 3
  KO
K12193  
charged multivesicular body protein 3
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Module
ESCRT-III complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    51652 (CHMP3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   51652 (CHMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p11.2
AA seq 222 aa AA seqDB search
MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVC
IVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKI
PEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKA
PSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATLRS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggggctgtttggaaagacccaggagaagccgcccaaagaactggtcaatgagtggtca
ttgaagataagaaaggaaatgagagttgttgacaggcaaataagggatatccaaagagaa
gaagaaaaagtgaaacgatctgtgaaagatgctgccaagaagggccagaaggatgtctgc
atagttctggccaaggagatgatcaggtcaaggaaggctgtgagcaagctgtatgcatcc
aaagcacacatgaactcagtgctcatggggatgaagaaccagctcgcggtcttgcgagtg
gctggttccctgcagaagagcacagaagtgatgaaggccatgcaaagtcttgtgaagatt
ccagagattcaggccaccatgagggagttgtccaaagaaatgatgaaggctgggatcata
gaggagatgttagaggacacttttgaaagcatggacgatcaggaagaaatggaggaagaa
gcagaaatggaaattgacagaattctctttgaaattacagcaggggccttgggcaaagca
cccagtaaagtgactgatgcccttccagagccagaacctccaggagcgatggctgcctca
gaggatgaggaggaggaggaagaggctctggaggccatgcagtcccggctggccacactc
cgcagctag

DBGET integrated database retrieval system