KEGG   Homo sapiens (human): 5166Help
Entry
5166              CDS       T01001                                 

Gene name
PDK4
Definition
pyruvate dehydrogenase kinase, isozyme 4 (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     5166 (PDK4)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   5166 (PDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q21.3
AA seq 411 aa AA seqDB search
MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQLLDFGSENACERTSFAFLRQE
LPVRLANILKEIDILPTQLVNTSSVQLVKSWYIQSLMDLVEFHEKSPDDQKALSDFVDTL
IKVRNRHHNVVPTMAQGIIEYKDACTVDPVTNQNLQYFLDRFYMNRISTRMLMNQHILIF
SDSQTGNPSHIGSIDPNCDVVAVVQDAFECSRMLCDQYYLSSPELKLTQVNGKFPDQPIH
IVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPIEVIVVLGKEDLTIKISDRGGGVPL
RIIDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDA
IIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggcccgcttcgtgctgcgcagcgctggctcgctcaacggcgccggcctggtg
ccccgagaggtggagcatttctcgcgctacagcccgtccccgctgtccatgaagcagcta
ctggactttggttcagaaaatgcatgtgaaagaacttcttttgcatttttgcgacaagaa
ttgcctgtgagactcgccaacattctgaaggaaattgatatcctcccgacccaattagta
aatacctcttcagtgcaattggttaaaagctggtatatacagagcctgatggatttggtg
gaattccatgagaaaagcccagatgaccagaaagcattatcagactttgtagatacactc
atcaaagttcgaaatagacaccataatgtagtccctacaatggcacaaggaatcatagag
tataaagatgcctgtacagttgacccagtcaccaatcaaaatcttcaatatttcttggat
cgattttacatgaaccgtatttctactcggatgctgatgaaccagcacattcttatattt
agtgactcacagacaggaaacccaagccacattggaagcattgatcctaactgtgatgtg
gtagcagtggtccaagatgcctttgagtgttcaaggatgctctgtgatcagtattattta
tcatctccagaattaaagcttacacaagtgaatggaaaatttccagaccaaccaattcac
atcgtgtatgttccttctcacctccatcatatgctctttgaactatttaagaatgcaatg
cgggcaacagttgaacaccaggaaaatcagccttcccttacaccaatagaggttattgtt
gtcttgggaaaagaagaccttaccattaagatttcagacagaggaggtggtgttcccctg
agaattattgaccgcctctttagttatacatactccactgcaccaacgcctgtgatggat
aattcccggaatgctcctttggctggttttggttacggcttgccaatttctcgtctgtat
gcaaagtactttcaaggagatctgaatctctactctttatcaggatatggaacagatgct
atcatctacttaaaggctttgtcttctgagtctatagaaaaacttccagtttttaacaag
tcagccttcaaacattatcagatgagctctgaggctgatgactggtgtatcccaagcagg
gaaccaaagaacctggcaaaagaagtggccatgtga

DBGET integrated database retrieval system