KEGG   Homo sapiens (human): 51704Help
Entry
51704             CDS       T01001                                 

Gene name
GPRC5B, RAIG-2, RAIG2
Definition
(RefSeq) G protein-coupled receptor class C group 5 member B
  KO
K04619  
G protein-coupled receptor family C group 5 member B
Organism
hsa  Homo sapiens (human)
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   51704 (GPRC5B)
G protein-coupled receptors [BR:hsa04030]
 Class C. Metabotropic glutamate receptor family
  Other
   Orphan GPRC5
    51704 (GPRC5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p12
AA seq 403 aa AA seqDB search
MFVASERKMRAHQVLTFLLLFVITSVASENASTSRGCGLDLLPQYVSLCDLDAIWGIVVE
AVAGAGALITLLLMLILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLTFAFIIQEDET
ICSVRRFLWGVLFALCFSCLLSQAWRVRRLVRHGTGPAGWQLVGLALCLMLVQVIIAVEW
LVLTVLRDTRPACAYEPMDFVMALIYDMVLLVVTLGLALFTLCGKFKRWKLNGAFLLITA
FLSVLIWVAWMTMYLFGNVKLQQGDAWNDPTLAITLAASGWVFVIFHAIPEIHCTLLPAL
QENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPS
GSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHLW
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtggcatcagagagaaagatgagagctcaccaggtgctcaccttcctcctgctc
ttcgtgatcacctcggtggcctctgaaaacgccagcacatcccgaggctgtgggctggac
ctcctccctcagtacgtgtccctgtgcgacctggacgccatctggggcattgtggtggag
gcggtggccggggcgggcgccctgatcacactgctcctgatgctcatcctcctggtgcgg
ctgcccttcatcaaggagaaggagaagaagagccctgtgggcctccactttctgttcctc
ctggggaccctgggcctctttgggctgacgtttgccttcatcatccaggaggacgagacc
atctgctctgtccgccgcttcctctggggcgtcctctttgcgctctgcttctcctgcctg
ctgagccaggcatggcgcgtgcggaggctggtgcggcatggcacgggccccgcgggctgg
cagctggtgggcctggcgctgtgcctgatgctggtgcaagtcatcatcgctgtggagtgg
ctggtgctcaccgtgctgcgtgacacaaggccagcctgcgcctacgagcccatggacttt
gtgatggccctcatctacgacatggtactgcttgtggtcaccctggggctggccctcttc
actctgtgcggcaagttcaagaggtggaagctgaacggggccttcctcctcatcacagcc
ttcctctctgtgctcatctgggtggcctggatgaccatgtacctcttcggcaatgtcaag
ctgcagcagggggatgcctggaacgaccccaccttggccatcacgctggcggccagcggc
tgggtcttcgtcatcttccacgccatccctgagatccactgcacccttctgccagccctg
caggagaacacgcccaactacttcgacacgtcgcagcccaggatgcgggagacggccttc
gaggaggacgtgcagctgccgcgggcctatatggagaacaaggccttctccatggatgaa
cacaatgcagctctccgaacagcaggatttcccaacggcagcttgggaaaaagacccagt
ggcagcttggggaaaagacccagcgctccgtttagaagcaacgtgtatcagccaactgag
atggccgtcgtgctcaacggtgggaccatcccaactgctccgccaagtcacacaggaaga
cacctttggtga

DBGET integrated database retrieval system