KEGG   Homo sapiens (human): 51807Help
Entry
51807             CDS       T01001                                 

Gene name
TUBA8, TUBAL2
Definition
(RefSeq) tubulin alpha 8
  KO
K07374  
tubulin alpha
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Apoptosis
Gap junction
Pathogenic Escherichia coli infection
Disease
H00271  
Polymicrogyria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    51807 (TUBA8)
  Cell growth and death
   04210 Apoptosis
    51807 (TUBA8)
  Cellular commiunity
   04540 Gap junction
    51807 (TUBA8)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    51807 (TUBA8)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     51807 (TUBA8)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules
    Other tubulins
     51807 (TUBA8)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    51807 (TUBA8)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   51807 (TUBA8)
  Exosomal proteins of other body fluids (saliva and urine)
   51807 (TUBA8)
  Exosomal proteins of colorectal cancer cells
   51807 (TUBA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q11.1
AA seq 449 aa AA seqDB search
MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQASKINDDDSFTTFFSETGNGK
HVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLD
RIRKLTDACSGLQGFLIFHSFGGGTGSGFTSLLMERLSLDYGKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPIISAEKAYHEQLSVAEITSSCFEPNS
QMVKCDPRHGKYMACCMLYRGDVVPKDVNVAIAAIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGTDSFEEENEGEEF
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaatgcatatcagtccacgtgggccaagcgggagttcagattggcaatgcctgc
tgggagctcttctgcctggaacacggcatccaggcagacggcacttttgatgctcaagct
agcaagatcaacgatgatgactccttcaccacctttttcagcgagactggcaatgggaag
catgtgccccgggccgtcatgatagatctggagcctactgtagtggatgaggttcgggca
ggaacctaccgccagctcttccatccagagcagctgatcacaggaaaggaggatgcagcc
aacaactatgcccggggccactacacggtgggcaaggagagcattgacctggtgctggac
cgcatacggaagctgacagatgcttgctctggcctgcagggcttcctgattttccacagt
tttggtgggggcactggctccggcttcacttctctgctgatggaacgcctctccctggat
tatggcaagaaatccaagctggagtttgccatctacccagccccccaggtctctactgca
gtggtggagccctacaactccatcctgaccacccacaccacactggaacattcagattgt
gctttcatggtggacaacgaagccatctatgacatctgccgcaggaaccttgacattgag
cgccctacctataccaacctcaaccgcctcatcagtcagattgtgtcctcaatcactgct
tctctccgctttgacggggccctcaatgtggacctcactgagttccagaccaacctggtg
ccctacccccgcatccacttcccgctggtcacctacgcgcccatcatctctgccgagaaa
gcctatcacgaacagctctctgtggccgagataaccagctcctgctttgagcccaacagc
cagatggtgaagtgcgacccgagacatggcaagtacatggcctgctgcatgctctaccgg
ggcgacgtggtgcccaaggatgtgaatgtcgctattgctgccatcaagaccaagaggacc
atccagtttgtagactggtgtcccacaggcttcaaggtgggcatcaactaccagcccccg
accgtggtccccgggggagacctggccaaggtgcagcgggccgtctgcatgctcagcaac
accacggccattgcggaggcctgggcccgcctcgaccacaagttcgacctcatgtacgcc
aagcgggcctttgtgcattggtatgtgggagaggggatggaagaaggagaattttctgag
gccagggaagacttagctgccctggagaaggattatgaagaagtggggactgattcgttt
gaagaagaaaatgaaggggaggaattttaa

DBGET integrated database retrieval system