KEGG   Homo sapiens (human): 51807Help
Entry
51807             CDS       T01001                                 

Gene name
TUBA8, TUBAL2
Definition
tubulin, alpha 8
Orthology
K07374  
tubulin alpha
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Gap junction
Pathogenic Escherichia coli infection
Disease
H00271  
Polymicrogyria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    51807 (TUBA8)
  Cell communication
   04540 Gap junction
    51807 (TUBA8)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    51807 (TUBA8)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   51807 (TUBA8)
  Exosomal proteins of other body fluids (saliva and urine)
   51807 (TUBA8)
  Exosomal proteins of colorectal cancer cells
   51807 (TUBA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q11.1
AA seq 383 aa AA seqDB search
MIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLDRIRKLT
DACSGLQGFLIFHSFGGGTGSGFTSLLMERLSLDYGKKSKLEFAIYPAPQVSTAVVEPYN
SILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDG
ALNVDLTEFQTNLVPYPRIHFPLVTYAPIISAEKAYHEQLSVAEITSSCFEPNSQMVKCD
PRHGKYMACCMLYRGDVVPKDVNVAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGG
DLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLA
ALEKDYEEVGTDSFEEENEGEEF
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgatagatctggagcctactgtagtggatgaggttcgggcaggaacctaccgccagctc
ttccatccagagcagctgatcacaggaaaggaggatgcagccaacaactatgcccggggc
cactacacggtgggcaaggagagcattgacctggtgctggaccgcatacggaagctgaca
gatgcttgctctggcctgcagggcttcctgattttccacagttttggtgggggcactggc
tccggcttcacttctctgctgatggaacgcctctccctggattatggcaagaaatccaag
ctggagtttgccatctacccagccccccaggtctctactgcagtggtggagccctacaac
tccatcctgaccacccacaccacactggaacattcagattgtgctttcatggtggacaac
gaagccatctatgacatctgccgcaggaaccttgacattgagcgccctacctataccaac
ctcaaccgcctcatcagtcagattgtgtcctcaatcactgcttctctccgctttgacggg
gccctcaatgtggacctcactgagttccagaccaacctggtgccctacccccgcatccac
ttcccgctggtcacctacgcgcccatcatctctgccgagaaagcctatcacgaacagctc
tctgtggccgagataaccagctcctgctttgagcccaacagccagatggtgaagtgcgac
ccgagacatggcaagtacatggcctgctgcatgctctaccggggcgacgtggtgcccaag
gatgtgaatgtcgctattgctgccatcaagaccaagaggaccatccagtttgtagactgg
tgtcccacaggcttcaaggtgggcatcaactaccagcccccgaccgtggtccccggggga
gacctggccaaggtgcagcgggccgtctgcatgctcagcaacaccacggccattgcggag
gcctgggcccgcctcgaccacaagttcgacctcatgtacgccaagcgggcctttgtgcat
tggtatgtgggagaggggatggaagaaggagaattttctgaggccagggaagacttagct
gccctggagaaggattatgaagaagtggggactgattcgtttgaagaagaaaatgaaggg
gaggaattttaa

DBGET integrated database retrieval system