KEGG   Homo sapiens (human): 5187Help
Entry
5187              CDS       T01001                                 

Gene name
PER1, PER, RIGUI, hPER
Definition
(RefSeq) period circadian clock 1
  KO
K21944  
period circadian protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Circadian rhythm
Circadian entrainment
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    5187 (PER1)
   04713 Circadian entrainment
    5187 (PER1)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    5187 (PER1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    5187 (PER1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O15534(Tbio)
UniProt: 
Position
17p13.1
AA seq 1290 aa AA seqDB search
MSGPLEGADGGGDPRPGESFCPGGVPSPGPPQHRPCPGPSLADDTDANSNGSSGNESNGH
ESRGASQRSSHSSSSGNGKDSALLETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPS
TSGCSSEQSARARTQKELMTALRELKLRLPPERRGKGRSGTLATLQYALACVKQVQANQE
YYQQWSLEEGEPCSMDMSTYTLEELEHITSEYTLQNQDTFSVAVSFLTGRIVYISEQAAV
LLRCKRDVFRGTRFSELLAPQDVGVFYGSTAPSRLPTWGTGASAGSGLRDFTQEKSVFCR
IRGGPDRDPGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEAPRIPPDKRIF
TTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPF
DHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPSPAP
SLDTDIQELSEQIHRLLLQPVHSPSPTGLCGVGAVTSPGPLHSPGSSSDSNGGDAEGPGP
PAPVTFQQICKDVHLVKHQGQQLFIESRARPQSRPRLPATGTFKAKALPCQSPDPELEAG
SAPVQAPLALVPEEAERKEASSCSYQQINCLDSILRYLESCNLPSTTKRKCASSSSYTTS
SASDDDRQRTGPVSVGTKKDPPSAALSGEGATPRKEPVVGGTLSPLALANKAESVVSVTS
QCSFSSTIVHVGDKKPPESDIIMMEDLPGLAPGPAPSPAPSPTVAPDPAPDAYRPVGLTK
AVLSLHTQKEEQAFLSRFRDLGRLRGLDSSSTAPSALGERGCHHGPAPPSRRHHCRSKAK
RSRHHQNPRAEAPCYVSHPSPVPPSTPWPTPPATTPFPAVVQPYPLPVFSPRGGPQPLPP
APTSVPPAAFPAPLVTPMVALVLPNYLFPTPSSYPYGALQTPAEGPPTPASHSPSPSLPA
LAPSPPHRPDSPLFNSRCSSPLQLNLLQLEELPRAEGAAVAGGPGSSAGPPPPSAEAAEP
EARLAEVTESSNQDALSGSSDLLELLLQEDSRSGTGSAASGSLGSGLGSGSGSGSHEGGS
TSASITRSSQSSHTSKYFGSIDSSEAEAGAARGGAEPGDQVIKYVLQDPIWLLMANADQR
VMMTYQVPSRDMTSVLKQDRERLRAMQKQQPRFSEDQRRELGAVHSWVRKGQLPRALDVM
ACVDCGSSTQDPGHPDDPLFSELDGLGLEPMEEGGGEQGSSGGGSGEGEGCEEAQGGAKA
SSSQDLAMEEEEEGRSSSSPALPTAGNCTS
NT seq 3873 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccccctagaaggggctgatgggggaggggaccccaggcctggggaatcattt
tgtcctgggggcgtcccatcccctgggcccccacagcaccggccttgcccaggccccagc
ctggccgatgacaccgatgccaacagcaatggttcaagtggcaatgagtccaacgggcat
gagtctagaggcgcatctcagcggagctcacacagctcctcctcaggcaacggcaaggac
tcagccctgctggagaccactgagagcagcaagagcacaaactctcagagcccatcccca
cccagcagttccattgcctacagcctcctgagtgccagctcagagcaggacaacccgtcc
accagtggctgcagcagtgaacagtcagcccgggcaaggactcagaaggaactcatgaca
gcacttcgagagctcaagcttcgactgccgccagagcgccggggcaagggccgctctggg
accctggccacgctgcagtacgcactggcctgtgtcaagcaggtgcaggccaaccaggaa
tactaccagcagtggagcctggaggagggcgagccttgctccatggacatgtccacctat
accctggaggagctggagcacatcacgtctgagtacacacttcagaaccaggataccttc
tcagtggctgtctccttcctgacgggccgaatcgtctacatttcggagcaggcagccgtc
ctgctgcgttgcaagcgggacgtgttccggggtacccgcttctctgagctcctggctccc
caggatgtgggagtcttctatggttccactgctccatctcgcctgcccacctggggcaca
ggggcctcagcaggttcaggcctcagggactttacccaggagaagtccgtcttctgccgt
atcagaggaggtcctgaccgggatccagggcctcggtaccagccattccgcctaaccccg
tatgtgaccaagatccgggtctcagatggggcccctgcacagccgtgctgcctgctgatt
gcagagcgcatccattcgggttacgaagctccccggataccccctgacaagaggattttc
actacgcggcacacacccagctgcctcttccaggatgtggatgaaagggctgcccccctg
ctgggctacctgccccaggacctcctgggggccccagtgctcctgttcctgcatcctgag
gaccgacccctcatgctggctatccacaagaagattctgcagttggcgggccagcccttt
gaccactcccctatccgcttctgtgcccgcaacggggagtatgtcaccatggacaccagc
tgggctggctttgtgcacccctggagccgcaaggtagccttcgtgttgggccgccacaaa
gtacgcacggcccccctgaatgaggacgtgttcactcccccggcccccagcccagctccc
tccctggacactgatatccaggagctgtcagagcagatccaccggctgctgctgcagccc
gtccacagccccagccccacgggactctgtggagtcggcgccgtgacatccccaggccct
ctccacagccctgggtcctccagtgatagcaacgggggtgatgcagaggggcctgggcct
cctgcgccagtgactttccagcagatctgtaaggatgtgcatctggtgaagcaccagggc
cagcagctttttattgagtctcgggcccggcctcagtcccggccccgcctccctgctaca
ggcacgttcaaggccaaggcccttccctgccaatccccagacccagagctggaggcgggt
tctgctcccgtccaggccccactagccttggtccctgaggaggccgagaggaaagaagcc
tccagctgctcctaccagcagatcaactgcctggacagcatcctcaggtacctggagagc
tgcaacctccccagcaccactaagcgtaaatgtgcctcctcctcctcctataccacctcc
tcagcctctgacgacgacaggcagaggacaggtccagtctctgtggggaccaagaaagat
ccgccgtcagcagcgctgtctggggagggggccaccccacggaaggagccagtggtggga
ggcaccctgagcccgctcgccctggccaataaggcggagagtgtggtgtccgtcaccagt
cagtgtagcttcagctccaccatcgtccatgtgggagacaagaagcccccggagtcggac
atcatcatgatggaggacctgcctggcctagccccaggcccagcccccagcccagccccc
agccccacagtagcccctgacccagccccagacgcctaccgtccagtggggctgaccaag
gccgtgctgtccctgcacacacagaaggaagagcaagccttcctcagccgcttccgagac
ctgggcaggctgcgtggactcgacagctcttccacagctccctcagcccttggcgagcga
ggctgccaccacggccccgcacccccaagccgccgacaccactgccgatccaaagccaag
cgctcacgccaccaccagaaccctcgggctgaagcgccctgctatgtctcacacccctca
cccgtgccaccctccaccccctggcccaccccaccagccactacccccttcccagcggtt
gtccagccctaccctctcccagtgttctctcctcgaggaggcccccagcctcttccccct
gctcccacatctgtgcccccagctgctttccccgcccctttggtgaccccaatggtggcc
ttggtgctccctaactatctgttcccaaccccatccagctatccttatggggcactccag
acccctgctgaagggcctcccactcctgcctcgcactccccttctccatccttgcccgcc
ctcgccccgagtcctcctcaccgcccggactctccactgttcaactcgagatgcagctct
ccactccagctcaatctgctgcagctggaggagctcccccgtgctgagggggctgctgtt
gcaggaggccctgggagcagtgccgggcccccacctcccagtgcggaggctgctgagcca
gaggccagactggcggaggtcactgagtcctccaatcaggacgcactttccggctccagt
gacctgctcgaacttctgctgcaagaggactcgcgctccggcacaggctccgcagcctcg
ggctccttgggctctggcttgggctctgggtctggttcaggctcccatgaagggggcagc
acctcagccagcatcactcgcagcagccagagcagccacacaagcaaatactttggcagc
atcgactcttccgaggctgaggctggggctgctcggggcggggctgagcctggggaccag
gtgattaagtacgtgctccaggatcccatttggctgctcatggccaatgctgaccagcgc
gtcatgatgacctaccaggtgccctccagggacatgacctctgtgctgaagcaggatcgg
gagcggctccgagccatgcagaagcagcagcctcggttttctgaggaccagcggcgggaa
ctgggtgctgtgcactcctgggtccggaagggccaactgcctcgggctcttgatgtgatg
gcctgtgtggactgtgggagcagcacccaagatcctggtcaccctgatgacccactcttc
tcagagctggatggactggggctggagcccatggaagagggtggaggcgagcagggcagc
agcggtggcggcagtggtgagggagagggctgcgaggaggcccaaggcggggccaaggct
tcaagctctcaggacttggctatggaggaggaggaagaaggcaggagctcatccagtcca
gccttacctacagcaggaaactgcaccagctag

DBGET integrated database retrieval system