KEGG   Homo sapiens (human): 5228Help
Entry
5228              CDS       T01001                                 

Gene name
PGF, D12S1900, PGFL, PIGF, PLGF, PlGF-2, SHGC-10760
Definition
(RefSeq) placental growth factor
  KO
K16859  placenta growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa05200  Pathways in cancer
Drug target
Aflibercept: D09574
Aflibercept beta: D10819
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5228 (PGF)
   04015 Rap1 signaling pathway
    5228 (PGF)
   04010 MAPK signaling pathway
    5228 (PGF)
   04151 PI3K-Akt signaling pathway
    5228 (PGF)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    5228 (PGF)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5228 (PGF)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   5228 (PGF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDGF
Motif
Other DBs
NCBI-GeneID: 5228
NCBI-ProteinID: NP_002623
OMIM: 601121
HGNC: 8893
Ensembl: ENSG00000119630
Vega: OTTHUMG00000171496
Pharos: P49763(Tclin)
UniProt: P49763 Q53XY6 Q86TW6
Structure
PDB: 

Jmol
Position
14q24.3
AA seq 170 aa AA seqDB search
MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVD
VVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVEL
TFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcatgaggctgttcccttgcttcctgcagctcctggccgggctggcgctgcct
gctgtgcccccccagcagtgggccttgtctgctgggaacggctcgtcagaggtggaagtg
gtacccttccaggaagtgtggggccgcagctactgccgggcgctggagaggctggtggac
gtcgtgtccgagtaccccagcgaggtggagcacatgttcagcccatcctgtgtctccctg
ctgcgctgcaccggctgctgcggcgatgagaatctgcactgtgtgccggtggagacggcc
aatgtcaccatgcagctcctaaagatccgttctggggaccggccctcctacgtggagctg
acgttctctcagcacgttcgctgcgaatgccggcctctgcgggagaagatgaagccggaa
aggaggagacccaagggcagggggaagaggaggagagagaagcagagacccacagactgc
cacctgtgcggcgatgctgttccccggaggtaa

DBGET integrated database retrieval system