KEGG   Homo sapiens (human): 5228Help
Entry
5228              CDS       T01001                                 

Gene name
PGF, D12S1900, PGFL, PLGF, PlGF-2, SHGC-10760
Definition
placental growth factor
Orthology
K16859  
placenta growth factor
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
Pathways in cancer
Drug target
Aflibercept: 
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q24.3
AA seq 149 aa AA seqDB search
MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVD
VVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVEL
TFSQHVRCECRPLREKMKPERCGDAVPRR
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcatgaggctgttcccttgcttcctgcagctcctggccgggctggcgctgcct
gctgtgcccccccagcagtgggccttgtctgctgggaacggctcgtcagaggtggaagtg
gtacccttccaggaagtgtggggccgcagctactgccgggcgctggagaggctggtggac
gtcgtgtccgagtaccccagcgaggtggagcacatgttcagcccatcctgtgtctccctg
ctgcgctgcaccggctgctgcggcgatgagaatctgcactgtgtgccggtggagacggcc
aatgtcaccatgcagctcctaaagatccgttctggggaccggccctcctacgtggagctg
acgttctctcagcacgttcgctgcgaatgccggcctctgcgggagaagatgaagccggaa
aggtgcggcgatgctgttccccggaggtaa

DBGET integrated database retrieval system