KEGG   Homo sapiens (human): 5228Help
Entry
5228              CDS       T01001                                 

Gene name
PGF, D12S1900, PGFL, PLGF, PlGF-2, SHGC-10760
Definition
placental growth factor
Orthology
K16859  
placenta growth factor
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
Pathways in cancer
Drug target
Aflibercept: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5228 (PGF)
   04015 Rap1 signaling pathway
    5228 (PGF)
   04151 PI3K-Akt signaling pathway
    5228 (PGF)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    5228 (PGF)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5228 (PGF)
Cytokines [BR:hsa04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass I
    5228 (PGF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q24.3
AA seq 149 aa AA seqDB search
MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVD
VVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVEL
TFSQHVRCECRPLREKMKPERCGDAVPRR
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcatgaggctgttcccttgcttcctgcagctcctggccgggctggcgctgcct
gctgtgcccccccagcagtgggccttgtctgctgggaacggctcgtcagaggtggaagtg
gtacccttccaggaagtgtggggccgcagctactgccgggcgctggagaggctggtggac
gtcgtgtccgagtaccccagcgaggtggagcacatgttcagcccatcctgtgtctccctg
ctgcgctgcaccggctgctgcggcgatgagaatctgcactgtgtgccggtggagacggcc
aatgtcaccatgcagctcctaaagatccgttctggggaccggccctcctacgtggagctg
acgttctctcagcacgttcgctgcgaatgccggcctctgcgggagaagatgaagccggaa
aggtgcggcgatgctgttccccggaggtaa

DBGET integrated database retrieval system