KEGG   Homo sapiens (human): 5243Help
Entry
5243              CDS       T01001                                 

Gene name
ABCB1, ABC20, CD243, CLCS, GP170, MDR1, P-GP, PGY1
Definition
ATP-binding cassette, sub-family B (MDR/TAP), member 1 (EC:3.6.3.44)
Orthology
K05658  
ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:3.6.3.44]
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Bile secretion
MicroRNAs in cancer
Drug target
Amiodarone: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    5243 (ABCB1)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    5243 (ABCB1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    5243 (ABCB1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.44  xenobiotic-transporting ATPase
     5243 (ABCB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5243 (ABCB1)
Cellular antigens [BR:hsa04090]
 Proteins
  5243 (ABCB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21.12
AA seq 1280 aa AA seqDB search
MDLEGDRNGGAKKKNFFKLNNKSEKDKKEKKPTVSVFSMFRYSNWLDKLYMVVGTLAAII
HGAGLPLMMLVFGEMTDIFANAGNLEDLMSNITNRSDINDTGFFMNLEEDMTRYAYYYSG
IGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDVS
KINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFT
DKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIG
AAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARG
AAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSG
QTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLF
ATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIA
IARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAG
FDDGVIVEKGNHDELMKEKGIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRS
SLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPYFVVGVFCAII
NGGLQPAFAIIFSKIIGVFTRIDDPETKRQNSNLFSLLFLALGIISFITFFLQGFTFGKA
GEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNI
ANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEA
IENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFG
AYLVAHKLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDS
YSTEGLMPNTLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVV
QLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVV
SQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLD
EATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQL
LAQKGIYFSMVSVQAGTKRQ
NT seq 3843 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgaaggggaccgcaatggaggagcaaagaagaagaacttttttaaactgaac
aataaaagtgaaaaagataagaaggaaaagaaaccaactgtcagtgtattttcaatgttt
cgctattcaaattggcttgacaagttgtatatggtggtgggaactttggctgccatcatc
catggggctggacttcctctcatgatgctggtgtttggagaaatgacagatatctttgca
aatgcaggaaatttagaagatctgatgtcaaacatcactaatagaagtgatatcaatgat
acagggttcttcatgaatctggaggaagacatgaccaggtatgcctattattacagtgga
attggtgctggggtgctggttgctgcttacattcaggtttcattttggtgcctggcagct
ggaagacaaatacacaaaattagaaaacagttttttcatgctataatgcgacaggagata
ggctggtttgatgtgcacgatgttggggagcttaacacccgacttacagatgatgtctcc
aagattaatgaaggaattggtgacaaaattggaatgttctttcagtcaatggcaacattt
ttcactgggtttatagtaggatttacacgtggttggaagctaacccttgtgattttggcc
atcagtcctgttcttggactgtcagctgctgtctgggcaaagatactatcttcatttact
gataaagaactcttagcgtatgcaaaagctggagcagtagctgaagaggtcttggcagca
attagaactgtgattgcatttggaggacaaaagaaagaacttgaaaggtacaacaaaaat
ttagaagaagctaaaagaattgggataaagaaagctattacagccaatatttctataggt
gctgctttcctgctgatctatgcatcttatgctctggccttctggtatgggaccaccttg
gtcctctcaggggaatattctattggacaagtactcactgtattcttttctgtattaatt
ggggcttttagtgttggacaggcatctccaagcattgaagcatttgcaaatgcaagagga
gcagcttatgaaatcttcaagataattgataataagccaagtattgacagctattcgaag
agtgggcacaaaccagataatattaagggaaatttggaattcagaaatgttcacttcagt
tacccatctcgaaaagaagttaagatcttgaagggtctgaacctgaaggtgcagagtggg
cagacggtggccctggttggaaacagtggctgtgggaagagcacaacagtccagctgatg
cagaggctctatgaccccacagaggggatggtcagtgttgatggacaggatattaggacc
ataaatgtaaggtttctacgggaaatcattggtgtggtgagtcaggaacctgtattgttt
gccaccacgatagctgaaaacattcgctatggccgtgaaaatgtcaccatggatgagatt
gagaaagctgtcaaggaagccaatgcctatgactttatcatgaaactgcctcataaattt
gacaccctggttggagagagaggggcccagttgagtggtgggcagaagcagaggatcgcc
attgcacgtgccctggttcgcaaccccaagatcctcctgctggatgaggccacgtcagcc
ttggacacagaaagcgaagcagtggttcaggtggctctggataaggccagaaaaggtcgg
accaccattgtgatagctcatcgtttgtctacagttcgtaatgctgacgtcatcgctggt
ttcgatgatggagtcattgtggagaaaggaaatcatgatgaactcatgaaagagaaaggc
atttacttcaaacttgtcacaatgcagacagcaggaaatgaagttgaattagaaaatgca
gctgatgaatccaaaagtgaaattgatgccttggaaatgtcttcaaatgattcaagatcc
agtctaataagaaaaagatcaactcgtaggagtgtccgtggatcacaagcccaagacaga
aagcttagtaccaaagaggctctggatgaaagtatacctccagtttccttttggaggatt
atgaagctaaatttaactgaatggccttattttgttgttggtgtattttgtgccattata
aatggaggcctgcaaccagcatttgcaataatattttcaaagattataggggtttttaca
agaattgatgatcctgaaacaaaacgacagaatagtaacttgttttcactattgtttcta
gcccttggaattatttcttttattacatttttccttcagggtttcacatttggcaaagct
ggagagatcctcaccaagcggctccgatacatggttttccgatccatgctcagacaggat
gtgagttggtttgatgaccctaaaaacaccactggagcattgactaccaggctcgccaat
gatgctgctcaagttaaaggggctataggttccaggcttgctgtaattacccagaatata
gcaaatcttgggacaggaataattatatccttcatctatggttggcaactaacactgtta
ctcttagcaattgtacccatcattgcaatagcaggagttgttgaaatgaaaatgttgtct
ggacaagcactgaaagataagaaagaactagaaggttctgggaagatcgctactgaagca
atagaaaacttccgaaccgttgtttctttgactcaggagcagaagtttgaacatatgtat
gctcagagtttgcaggtaccatacagaaactctttgaggaaagcacacatctttggaatt
acattttccttcacccaggcaatgatgtatttttcctatgctggatgtttccggtttgga
gcctacttggtggcacataaactcatgagctttgaggatgttctgttagtattttcagct
gttgtctttggtgccatggccgtggggcaagtcagttcatttgctcctgactatgccaaa
gccaaaatatcagcagcccacatcatcatgatcattgaaaaaacccctttgattgacagc
tacagcacggaaggcctaatgccgaacacattggaaggaaatgtcacatttggtgaagtt
gtattcaactatcccacccgaccggacatcccagtgcttcagggactgagcctggaggtg
aagaagggccagacgctggctctggtgggcagcagtggctgtgggaagagcacagtggtc
cagctcctggagcggttctacgaccccttggcagggaaagtgctgcttgatggcaaagaa
ataaagcgactgaatgttcagtggctccgagcacacctgggcatcgtgtcccaggagccc
atcctgtttgactgcagcattgctgagaacattgcctatggagacaacagccgggtggtg
tcacaggaagagattgtgagggcagcaaaggaggccaacatacatgccttcatcgagtca
ctgcctaataaatatagcactaaagtaggagacaaaggaactcagctctctggtggccag
aaacaacgcattgccatagctcgtgcccttgttagacagcctcatattttgcttttggat
gaagccacgtcagctctggatacagaaagtgaaaaggttgtccaagaagccctggacaaa
gccagagaaggccgcacctgcattgtgattgctcaccgcctgtccaccatccagaatgca
gacttaatagtggtgtttcagaatggcagagtcaaggagcatggcacgcatcagcagctg
ctggcacagaaaggcatctatttttcaatggtcagtgtccaggctggaacaaagcgccag
tga

DBGET integrated database retrieval system