KEGG   Homo sapiens (human): 5257Help
Entry
5257              CDS       T01001                                 

Gene name
PHKB
Definition
phosphorylase kinase, beta (EC:2.7.11.19)
Orthology
K07190  
phosphorylase kinase alpha/beta subunit
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Disease
H00069  
Glycogen storage diseases (GSD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    5257 (PHKB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5257 (PHKB)
   04922 Glucagon signaling pathway
    5257 (PHKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q12-q13
AA seq 1093 aa AA seqDB search
MAGAAGLTAEVSWKVLERRARTKRSGSVYEPLKSINLPRPDNETLWDKLDHYYRIVKSTL
LLYQSPTTGLFPTKTCGGDQKAKIQDSLYCAAGAWALALAYRRIDDDKGRTHELEHSAIK
CMRGILYCYMRQADKVQQFKQDPRPTTCLHSVFNVHTGDELLSYEEYGHLQINAVSLYLL
YLVEMISSGLQIIYNTDEVSFIQNLVFCVERVYRVPDFGVWERGSKYNNGSTELHSSSVG
LAKAALEAINGFNLFGNQGCSWSVIFVDLDAHNRNRQTLCSLLPRESRSHNTDAALLPCI
SYPAFALDDEVLFSQTLDKVVRKLKGKYGFKRFLRDGYRTSLEDPNRCYYKPAEIKLFDG
IECEFPIFFLYMMIDGVFRGNPKQVQEYQDLLTPVLHHTTEGYPVVPKYYYVPADFVEYE
KNNPGSQKRFPSNCGRDGKLFLWGQALYIIAKLLADELISPKDIDPVQRYVPLKDQRNVS
MRFSNQGPLENDLVVHVALIAESQRLQVFLNTYGIQTQTPQQVEPIQIWPQQELVKAYLQ
LGINEKLGLSGRPDRPIGCLGTSKIYRILGKTVVCYPIIFDLSDFYMSQDVFLLIDDIKN
ALQFIKQYWKMHGRPLFLVLIREDNIRGSRFNPILDMLAALKKGIIGGVKVHVDRLQTLI
SGAVVEQLDFLRISDTEELPEFKSFEELEPPKHSKVKRQSSTPSAPELGQQPDVNISEWK
DKPTHEILQKLNDCSCLASQAILLGILLKREGPNFITKEGTVSDHIERVYRRAGSQKLWL
AVRYGAAFTQKFSSSIAPHITTFLVHGKQVTLGAFGHEEEVISNPLSPRVIQNIIYYKCN
THDEREAVIQQELVIHIGWIISNNPELFSGMLKIRIGWIIHAMEYELQIRGGDKPALDLY
QLSPSEVKQLLLDILQPQQNGRCWLNRRQIDGSLNRTPTGFYDRVWQILERTPNGIIVAG
KHLPQQPTLSDMTMYEMNFSLLVEDTLGNIDQPQYRQIVVELLMVVSIVLERNPELEFQD
KVDLDRLVKEAFNEFQKDQSRLKEIEKQDDMTSFYNTPPLGKRGTCSYLTKAVMNLLLEG
EVKPNNDDPCLIS
NT seq 3282 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggcggcgggactcacggcagaagtgagctggaaggtcttggagcgaagagct
cggaccaagcgctcaggctcagtttatgaacctcttaaaagcattaatcttccaagacct
gataatgaaactctctgggataagttggaccattattacagaattgtcaagtcaacattg
ctgctgtatcaaagtccaactaccggtctctttcccactaaaacatgcggtggtgaccag
aaggccaagatccaggacagcctatactgcgctgctggggcctgggctttggctcttgca
tacaggcgaattgatgatgacaagggaaggacccatgagctggagcactcagctataaaa
tgcatgagaggaattctctactgctatatgcgtcaggccgataaggtccagcagtttaag
caggatccacgcccaacaacatgtcttcactctgttttcaatgtgcatacaggagatgag
ttgctttcctatgaggaatatggtcatcttcagataaatgcagtgtcactttatctcctt
taccttgtggaaatgatttcctcaggactccagattatctacaacactgatgaggtctct
tttattcaaaaccttgtattttgtgtggaaagagtttaccgtgtgcctgactttggtgtc
tgggaaagaggaagcaaatataataatggcagcacagagctacattcgagctcggttggt
ttagcaaaagcagctctagaagcaattaatggattcaacctttttggcaaccagggctgt
tcgtggtcagttatatttgtggatctcgatgctcacaatcgcaacaggcaaactttgtgc
tcgctgttacccagagaatcaagatcacataatacagatgctgccctgctcccctgcatc
agttatcctgcatttgccctggatgatgaagttctttttagccagacacttgataaagtg
gttagaaaattaaaaggaaaatatggatttaaacgtttcttgagagatgggtatagaaca
tcattggaagatcccaacagatgctactacaagccagctgaaattaagctatttgatggc
attgaatgtgaatttcccatatttttcctttatatgatgattgatggagtttttagaggc
aatcctaagcaagtacaggaatatcaggatcttttgactccagtacttcatcataccaca
gaaggatatcctgttgtaccaaagtactattatgtgccagctgactttgtagaatatgaa
aaaaataaccctggtagtcaaaaacgatttcctagcaactgtggccgtgatggaaaactg
tttctttggggacaagcactttatatcatcgcaaaactcctggctgatgaacttattagt
cctaaagacattgatcctgtccagcgctatgtcccactaaaggatcaacgtaacgtgagc
atgaggttttccaatcagggcccactggaaaatgacttggtagttcatgtggcacttata
gcagaaagccaaagacttcaagtttttctgaacacatatggtattcaaactcaaactcct
caacaagtagaacccattcagatatggcctcagcaggagcttgtgaaagcttatttgcag
ctgggtatcaatgaaaagttaggactctctggaaggccagacaggcccattggctgcctc
gggacatcaaagatttatcgcattctaggaaagactgtggtttgttacccgattattttc
gacctaagtgatttctacatgtctcaggatgttttcctgctgatagatgacataaagaat
gcgctgcagttcattaaacaatattggaaaatgcatggacgtccacttttccttgttctc
atccgggaagacaatataagaggtagccggttcaaccccatattagatatgctggcagcc
cttaaaaaaggaataattggaggagtcaaagttcatgtggatcgtctacagacactaata
tctggagctgtggtagaacaacttgatttcctacgaatcagtgacacagaagagcttcca
gaatttaagagttttgaggaactagaacctcccaaacattcaaaagtcaaacggcaaagc
agcacccctagtgctcctgaactgggacagcagccggatgtcaacattagtgaatggaag
gacaaacccacccacgaaattcttcaaaaactgaatgattgcagttgtctggctagccaa
gccatcctgctgggtatactgctcaaaagagaaggccccaacttcatcacaaaggaaggt
accgtttctgatcacattgagagagtctatagaagagctggcagccaaaaactttggttg
gcggtgcgctacggggctgcatttacccagaaattttcttcctctatagccccacacatt
actacttttctggtacatgggaaacaggtaactctgggtgcctttgggcatgaagaagaa
gttatctctaatcctttgtctccaagagtgattcaaaacatcatctattataagtgtaac
acccatgatgagagggaagcggtcattcagcaagaactggtcatccatattggctggatc
atctccaataaccctgagttattcagtggcatgctgaaaatacgaatcgggtggatcatc
catgccatggagtatgaacttcagatccgtggcggagacaagccagccttggacttgtat
cagctgtcacctagtgaagttaaacagcttctgctggatattctgcagcctcaacagaat
ggaagatgttggctgaacaggcgtcagatcgatgggtctttgaatagaactcccaccggg
ttctatgaccgagtgtggcagattctggagcgcacgcccaatgggatcattgttgctggg
aagcatttgcctcagcaaccaaccctgtcagatatgaccatgtatgagatgaatttctct
ctccttgttgaagacacgttgggaaatattgaccagccacagtacagacagatcgttgta
gagttacttatggttgtatccattgtactggaaagaaaccccgagctagaatttcaagac
aaagtagatctagacagactggtcaaagaagcatttaatgaatttcaaaaagatcagagt
cggctaaaggaaattgaaaaacaagatgacatgacttccttttacaacactcctcccctg
ggaaaaagaggaacatgcagctatttgacaaaggcggtgatgaatctgctgctggaagga
gaagtcaagccaaacaatgatgacccgtgtctgattagctag

DBGET integrated database retrieval system