KEGG   Homo sapiens (human): 5287Help
Entry
5287              CDS       T01001                                 

Gene name
PIK3C2B, C2-PI3K
Definition
(RefSeq) phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta
  KO
K00923  
phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5287 (PIK3C2B)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    5287 (PIK3C2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     5287 (PIK3C2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O00750(Tchem)
UniProt: 
Position
1q32.1
AA seq 1634 aa AA seqDB search
MSSTQGNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEENRAKQNADPSLISW
DEPGVDFYSKPAGRRTDLKLLRGLSGSDPTLNYNSLSPQEGPPNHSTSQGPQPGSDPWPK
GSLSGDYLYIFDGSDGGVSSSPGPGDIEGSCKKLSPPPLPPRASIWDTPPLPPRKGSPSS
SKISQPSDINTFSLVEQLPGKLLEHRILEEEEVLGGGGQGRLLGSVDYDGINDAITRLNL
KSTYDAEMLRDATRGWKEGRGPLDFSKDTSGKPVARSKTMPPQVPPRTYASRYGNRKNAT
PGKNRRISAAPVGSRPHTVANGHELFEVSEERDEEVAAFCHMLDILRSGSDIQDYFLTGY
VWSAVTPSPEHLGDEVNLKVTVLCDRLQEALTFTCNCSSTVDLLIYQTLCYTHDDLRNVD
VGDFVLKPCGLEEFLQNKHALGSHEYIQYCRKFDIDIRLQLMEQKVVRSDLARTVNDDQS
PSTLNYLVHLQERPVKQTISRQALSLLFDTYHNEVDAFLLADGDFPLKADRVVQSVKAIC
NALAAVETPEITSALNQLPPCPSRMQPKIQKDPSVLAVRENREKVVEALTAAILDLVELY
CNTFNADFQTAVPGSRKHDLVQEACHFARSLAFTVYATHRIPIIWATSYEDFYLSCSLSH
GGKELCSPLQTRRAHFSKYLFHLIVWDQQICFPVQVNRLPRETLLCATLYALPIPPPGSS
SEANKQRRVPEALGWVTTPLFNFRQVLTCGRKLLGLWPATQENPSARWSAPNFHQPDSVI
LQIDFPTSAFDIKFTSPPGDKFSPRYEFGSLREEDQRKLKDIMQKESLYWLTDADKKRLW
EKRYYCHSEVSSLPLVLASAPSWEWACLPDIYVLLKQWTHMNHQDALGLLHATFPDQEVR
RMAVQWIGSLSDAELLDYLPQLVQALKYECYLDSPLVRFLLKRAVSDLRVTHYFFWLLKD
GLKDSQFSIRYQYLLAALLCCCGKGLREEFNRQCWLVNALAKLAQQVREAAPSARQGILR
TGLEEVKQFFALNGSCRLPLSPSLLVKGIVPRDCSYFNSNAVPLKLSFQNVDPLGENIRV
IFKCGDDLRQDMLTLQMIRIMSKIWVQEGLDMRMVIFRCFSTGRGRGMVEMIPNAETLRK
IQVEHGVTGSFKDRPLADWLQKHNPGEDEYEKAVENFIYSCAGCCVATYVLGICDRHNDN
IMLKTTGHMFHIDFGRFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSSRFHDFVDL
CCQAYNLIRKHTHLFLNLLGLMLSCGIPELSDLEDLKYVYDALRPQDTEANATTYFTRLI
ESSLGSVATKLNFFIHNLAQMKFTGSDDRLTLSFASRTHTLKSSGRISDVFLCRHEKIFH
PNKGYIYVVKVMRENTHEATYIQRTFEEFQELHNKLRLLFPSSHLPSFPSRFVIGRSRGE
AVAERRREELNGYIWHLIHAPPEVAECDLVYTFFHPLPRDEKAMGTSPAPKSSDGTWARP
VGKVGGEVKLSISYKNNKLFIMVMHIRGLQLLQDGNDPDPYVKIYLLPDPQKTTKRKTKV
ARKTCNPTYNEMLVYDGIPKGDLQQRELQLSVLSEQGFWENVLLGEVNIRLRELDLAQEK
TGWFALGSRSHGTL
NT seq 4905 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgactcagggcaatggggaacactggaagtccctggagtcagtgggcatcagc
cgcaaagagctagcgatggccgaagccctgcagatggagtatgatgccctgtcccggctc
cggcatgacaaggaggagaacagagccaagcagaacgcagacccctctctcatcagctgg
gatgagcctggggtagacttttacagcaagccagcaggaaggcggaccgacctcaagctg
ttacgcggtctctctggctctgatcctacccttaactacaactcactctccccacaggaa
gggccgcccaaccactctacctcccaagggccacagcctggctcagatccctggcccaaa
ggctccctgtctggagactatctctacatttttgatggttcagatgggggagtctcttcg
tccccaggaccaggggacatagagggctcttgcaagaaactatccccacctcctctgcct
ccccgagcttctatctgggatacccctcccctgcctcccagaaaggggtccccctcatcc
tccaagatctcccagcccagtgacatcaacactttctctttggtcgaacaattgccgggc
aaactgctagagcatcggatcctagaagaggaagaggtgctgggaggtgggggtcagggg
cgcctactggggtctgtggactatgatggtatcaatgatgcaattactaggctcaacttg
aaatcgacctatgatgcggagatgttgcgggatgccaccaggggctggaaggagggccga
gggccgctggacttcagcaaagacacctctggaaaacccgtggccaggagcaagactatg
ccccctcaggtgcccccccgcacctatgcctcccgctatggcaaccgaaagaatgcgacg
cctggcaagaaccgccggatttctgcagccccggtgggctcccggccccacactgttgcc
aatggccatgagttgtttgaggtctcagaagagagagatgaggaggttgctgcattttgc
cacatgctggatatccttcgatctggctctgacatccaagactacttcctcactggctat
gtctggagtgctgtcacccctagcccagagcacctcggggatgaggtcaacctgaaggtg
actgtgttgtgtgacaggcttcaagaggcactcactttcacctgcaactgttcctccact
gtagacttgcttatctaccagaccctgtgctacacccatgatgacctgaggaatgtggac
gtgggtgactttgtgctaaagccctgcgggctggaggagttcctgcagaacaagcatgcc
ttgggcagtcatgagtacatccaatactgccgcaagtttgacattgacattcggctacag
ctgatggagcagaaggttgtgcgcagtgacctggcccggacggtgaatgatgaccagagc
ccctccaccttgaactacctcgtccatctccaagagaggcctgtcaagcagaccatcagc
aggcaggccctgagtcttctgttcgacacttaccacaatgaggtggatgccttcctgctg
gctgatggagacttcccactgaaggctgacagggtggtccagtccgtcaaggccatctgc
aacgccctggccgccgtggaaacccctgagatcaccagtgctctcaaccagctgcccccc
tgcccctcccgcatgcagcctaaaattcagaaggatcccagtgtcttggctgtgagggaa
aaccgagagaaggtcgtggaagccctgaccgctgccatcttggacctggtggagctgtac
tgcaacacattcaacgcagacttccagacggcagtgcccgggagccgcaagcatgacctg
gtccaggaggcctgccatttcgccaggtccctggccttcactgtctatgccacccaccgc
atccccatcatctgggctaccagctatgaagatttctacctctcctgctccctcagccat
ggcggcaaggagctgtgcagccccctgcagacccgaagagctcacttctccaagtacctc
ttccacctcatcgtctgggaccagcagatctgcttcccagtgcaggtgaaccggctgcct
cgggagacactgctgtgtgccactctctatgctctgcccatccccccaccggggagctcc
tcagaggccaataagcagcggcgggtgcctgaagccctgggctgggtcactaccccactc
ttcaacttcaggcaggtcctgacctgtggccggaagcttctgggtttgtggccagcaaca
caggaaaatcccagcgcccgttggagtgcacctaatttccaccagccagacagtgtcatc
ctgcagattgacttccccacctcggcctttgacatcaagttcaccagcccccctggagac
aagttcagcccccgctatgagtttggcagcctccgggaagaagaccagcgcaagcttaaa
gacatcatgcagaaagagtccttgtactggctcactgatgctgacaagaagcgcctgtgg
gagaagcgatattactgccactcggaggtgagctcgctccccctggtgctcgccagcgcc
cccagctgggagtgggcttgcctgcctgacatctatgttctcctgaagcagtggacccac
atgaaccaccaggatgccctggggctcctgcatgccaccttcccggaccaggaggtgcgt
cgtatggctgtgcagtggattggctcactctcagatgctgagctgctagactacctgccc
cagctggtacaggccctgaagtatgaatgctacctggacagcccgttggtgcgcttcctc
ctgaaacgagctgtgtctgacttgagagtgactcactacttcttctggttactgaaggac
ggcctcaaggactctcagttcagcatccgctaccagtatctgctggcagccttactgtgc
tgctgtggcaaggggctgagagaagagtttaaccgccagtgctggcttgtcaatgccctg
gccaaactggcccagcaggtccgggaggcagccccatctgcaaggcagggaatcctccgc
acgggcctggaggaggtgaagcagttctttgccctcaatggctcgtgccgcttgccactc
agccccagtctgctggttaagggaattgtgcccagggactgttcctacttcaactccaat
gctgtccccctcaaactctccttccaaaatgtggatcccctgggtgagaacatccgtgtc
atcttcaagtgtggggacgaccttcgccaggacatgctaacgctgcagatgattcgcatc
atgagcaagatctgggtccaggaggggctggacatgcgcatggtcatcttccgctgcttc
tccaccggccggggcagagggatggtggagatgatccctaatgctgagaccctgcgtaag
atccaggtggagcatggggtgaccggctcgttcaaggaccggcccctggcagactggctg
cagaaacacaaccctggggaggacgagtatgagaaggctgtggagaactttatctactcc
tgcgctggctgctgcgtggccacgtacgtcttgggcatctgtgaccgacataatgacaac
atcatgctgaagaccactggtcacatgttccacattgattttggccgcttcctgggccat
gcccagatgtttggcaacatcaagcgggaccgtgccccctttgtcttcacctcggacatg
gcgtatgtcatcaacgggggtgacaagccttccagccgcttccatgattttgttgacctt
tgctgccaagcctacaacctcattcgcaagcacacccacctcttcctcaaccttctgggc
ctgatgttgtcctgtgggatccctgaactctcagacctggaggacctcaagtatgtgtac
gatgccctgaggcctcaggatacagaggccaatgccactacctacttcactaggttgatt
gagtccagcctgggcagtgtagccacaaagctcaattttttcatccataatctggctcag
atgaagttcacgggctcagatgaccggctgaccctctcctttgcctcccgaacacacact
ctcaagagctctggccgaatcagtgatgttttcctctgccgccatgagaagatcttccac
cccaacaaaggctatatatatgtggtaaaggtgatgcgagagaacactcacgaggccacc
tacatccagcggacctttgaggagttccaggaattacacaataagttgcggctgctcttc
ccttcttcccacttgcccagcttccctagtcgcttcgtgatcggccgctcccggggagag
gcggtggccgagcggcggagggaggagctaaacggttacatctggcacttgatccacgca
ccccctgaggtggccgagtgtgatttggtgtacaccttcttccacccactgccccgggat
gagaaggctatgggcaccagcccagctcctaagtcctcagatggcacatgggcccggccc
gtcggaaaggtgggaggggaggtgaagctgtccatctcctacaaaaacaataaactcttc
atcatggtgatgcatattcggggcttgcaactgctccaggatggaaatgaccctgacccc
tatgtgaaaatttacctccttcctgaccctcagaaaaccactaagaggaaaaccaaagtg
gcccggaaaacctgcaatcctacctacaatgagatgttggtatatgatgggatccccaag
ggtgacctgcagcagcgggagctccagctgagcgtgctgagtgagcagggattctgggag
aacgtcctcctcggtgaggtgaacatccgcctgcgagagctggacctggctcaggagaag
accggctggttcgccctgggatctcgaagtcatggcaccttgtga

DBGET integrated database retrieval system