KEGG   Homo sapiens (human): 5288Help
Entry
5288              CDS       T01001                                 

Gene name
PIK3C2G, PI3K-C2-gamma, PI3K-C2GAMMA
Definition
(RefSeq) phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 gamma (EC:2.7.1.154)
  KO
K00923  
phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5288 (PIK3C2G)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    5288 (PIK3C2G)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     5288 (PIK3C2G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p12
AA seq 1445 aa AA seqDB search
MAYSWQTDPNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGKIPHYESEIDE
NTFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELSWHQVSKAPAIGFSPSVLPKPQNT
NKECSWGSPIGKHHGADDSRFSILAPSFTSLDKINLEKELENENHNYHIGFESSIPPTNS
SFSSDFMPKEENKRSGHVNIVEPSLMLLKGSLQPGMWESTWQKNIESIGCSIQLVEVPQS
SNTSLASFCNKVKKIRERYHAADVNFNSGKIWSTTTAFPYQLFSKTKFNIHIFIDNSTQP
LHFMPCANYLVKDLIAEILHFCTNDQLLPKDHILSVCGSEEFLQNDHCLGSHKMFQKDKS
VIQLHLQKSREAPGKLSRKHEEDHSQFYLNQLLEFMHIWKVSRQCLLTLIRKYDFHLKYL
LKTQENVYNIIEEVKKICSVLGCVETKQITDAVNELSLILQRKGENFYQSSETSAKGLIE
KVTTELSTSIYQLINVYCNSFYADFQPVNVPRCTSYLNPGLPSHLSFTVYAAHNIPETWV
HRINFPLEIKSLPRESMLTVKLFGIACATNNANLLAWTCLPLFPKEKSILGSMLFSMTLQ
SEPPVEMITPGVWDVSQPSPVTLQIDFPATGWEYMKPDSEENRSNLEEPLKECIKHIARL
SQKQTPLLLSEEKKRYLWFYRFYCNNENCSLPLVLGSAPGWDERTVSEMHTILRRWTFSQ
PLEALGLLTSSFPDQEIRKVAVQQLDNLLNDELLEYLPQLVQAVKFEWNLESPLVQLLLH
RSLQSIQVAHRLYWLLKNAENEAYFKSWYQKLLAALQFCAGKALNDEFSKEQKLIKILGD
IGERVKSASDHQRQEVLKKEIGRLEEFFQDVNTCHLPLNPALCIKGIDHDACSYFTSNAL
PLKITFINANPMGKNISIIFKAGDDLRQDMLVLQLIQVMDNIWLQEGLDMQMIIYRCLST
GKDQGLVQMVPDAVTLAKIHRHSGLIGPLKENTIKKWFSQHNHLKADYEKALRNFFYSCA
GWCVVTFILGVCDRHNDNIMLTKSGHMFHIDFGKFLGHAQTFGGIKRDRAPFIFTSEMEY
FITEGGKNPQHFQDFVELCCRAYNIIRKHSQLLLNLLEMMLYAGLPELSGIQDLKYVYNN
LRPQDTDLEATSHFTKKIKESLECFPVKLNNLIHTLAQMSAISPAKSTSQTFPQESCLLS
TTRSIERATILGFSKKSSNLYLIQVTHSNNETSLTEKSFEQFSKLHSQLQKQFASLTLPE
FPHWWHLPFTNSDHRRFRDLNHYMEQILNVSHEVTNSDCVLSFFLSEAVQQTVEESSPVY
LGEKFPDKKPKVQLVISYEDVKLTILVKHMKNIHLPDGSAPSAHVEFYLLPYPSEVRRRK
TKSVPKCTDPTYNEIVVYDEVTELQGHVLMLIVKSKTVFVGAINIRLCSVPLDKEKWYPL
GNSII
NT seq 4338 nt NT seq  +upstreamnt  +downstreamnt
atggcatattcttggcaaacggatccaaatcctaatgaatcacacgaaaagcagtatgaa
caccaagaatttctctttgtaaatcaaccccattcttctagccaagtcagtctgggtttt
gatcagatagtagatgagatcagtggcaaaattccacactacgagagtgaaattgatgaa
aacaccttttttgtgcccactgcaccaaaatgggactcaacagggcattcattaaatgaa
gcacaccaaatatccttgaatgaattcacttctaaaagccgtgaactctcctggcatcaa
gttagcaaagcaccagcaattggttttagtccttctgtgttaccaaaacctcaaaatacg
aataaagaatgctcctggggaagccccataggaaaacatcatggtgctgatgattccaga
ttcagtattttagctccatcattcacaagtttggataaaattaatctagagaaagaatta
gaaaatgaaaatcataactaccatataggatttgaaagtagcattcctccaacaaattca
tccttctcaagtgacttcatgccgaaagaagagaataaaaggagtggacatgtgaacatt
gtggaaccatctttgatgcttttgaaaggctctcttcaacccggaatgtgggaaagtaca
tggcagaagaatatagagtcaataggttgttccattcagctagtggaagtacctcaaagc
agcaatacgagtctggcctctttttgcaacaaagtaaaaaaaatcagagaaagatatcat
gcagctgatgttaatttcaattctgggaagatctggagcactactacagcatttccgtat
cagctcttttctaagaccaagtttaatatacatatttttattgataactcaacacaacct
cttcattttatgccatgtgctaattatcttgtcaaagatctaattgcagaaattctgcat
ttttgcacaaatgaccagctactccccaaagatcatattctaagtgtatgtggctctgaa
gaatttttacaaaacgaccactgtttggggagccacaaaatgtttcaaaaagataaatct
gttattcagctccacctgcagaaaagtagggaagctccaggaaagctatctcgaaagcat
gaagaggaccacagtcagttttatctgaatcaacttctagaatttatgcatatttggaaa
gtatccagacaatgtctcttaacactcatcagaaaatatgacttccacctgaaataccta
ttgaaaacccaggaaaacgtgtataatattattgaagaagttaaaaaaatatgcagtgtt
ctagggtgtgtggaaaccaaacaaattacagatgcagtaaatgaactaagtctaattctt
cagagaaaaggagagaatttttatcaaagttcagagacttcagcaaaaggcttgatagag
aaggtaacaactgaactatccacatccatctaccagctaatcaatgtctactgtaacagc
ttttatgcagattttcagcctgtaaatgtacctagatgcacttcctatctaaatcccggg
cttccttcccacctcagcttcacagtgtatgcagcacacaacattccagaaacctgggtg
cacaggatcaattttccccttgaaataaagtcacttccaagggaatccatgctcactgta
aaactgtttgggattgcctgtgcaaccaacaatgcaaatttactggcgtggacttgtctt
ccactgtttccaaaagaaaaatccattctcgggtctatgctgttcagcatgacattacag
agtgagcctcccgtagaaatgataactccaggagtgtgggatgtaagtcagccatccccg
gtgaccctgcagattgattttccagctactgggtgggagtatatgaaacctgattctgaa
gagaatagaagtaatcttgaagagccactaaaggagtgtataaaacatattgccagactt
tcacagaaacagactcccctactactctctgaagaaaagaaaagatatttatggttttat
cgcttctactgcaataatgaaaactgctcccttcctttagtcctgggtagtgcccctgga
tgggatgaaaggactgtttcagaaatgcataccattttgagaagatggacattttctcaa
cctttagaggctcttgggcttttgacttccagttttccagatcaagaaattcgtaaagtg
gcagttcaacaattagacaacctcttgaatgatgaactactggaatatctcccacagcta
gttcaggctgtcaagtttgaatggaaccttgagagtcctttagtgcaacttctactccac
cgctccttgcagagcatccaggttgcccatcgtctttactggctgctaaaaaatgcagaa
aatgaagcttattttaaaagctggtatcagaagctactagctgctctccaattctgtgca
ggtaaagccttgaatgatgagttttccaaggagcagaaacttatcaaaattctgggagat
attggggaaagagtcaagtctgccagtgaccatcaaagacaggaggtactgaagaaagaa
attggcagactagaagagttctttcaagatgtaaatacttgtcatcttcctctgaaccct
gccctatgtataaaagggattgatcacgatgcatgttcatattttacatctaatgctttg
ccattgaagattactttcatcaatgctaatccgatgggcaaaaacatcagcattattttt
aaggctggagatgatcttcgtcaggatatgcttgttctgcagcttattcaagtgatggac
aatatttggctgcaggaaggcttggatatgcaaatgatcatttatagatgtctatccaca
ggaaaagaccaaggattggtgcagatggtacctgatgctgtgaccctagcaaagattcat
cgccattctggactgataggaccattgaaagaaaatacaattaaaaagtggttcagtcag
cacaaccacttaaaggcagattatgaaaaggccttgaggaactttttctactcctgtgct
ggctggtgtgtggtaacattcatcctgggagtatgtgaccgtcacaatgataatatcatg
ctgacaaagtcgggccacatgtttcatattgactttggaaaattcttaggtcatgcacaa
acatttggagggataaaaagggaccgagctcctttcatttttacttcagagatggaatac
tttattacagagggtgggaaaaacccacagcattttcaagattttgtggaactttgctgt
cgtgcttataatattatcagaaagcacagccaactgctcttgaacctgctggaaatgatg
ctgtatgcaggactgcctgagctaagtggaattcaagacctgaaatatgtgtataataat
cttcgtccacaagacacagacctggaagcaacaagtcattttaccaagaaaataaaggaa
agtctggagtgtttccctgttaaattgaataacttgatccacacacttgcacaaatgtca
gccataagccctgccaaatctacttcacagacttttcctcaggaatcctgtttgctgagt
acaactaggtcgattgaaagagcaacaattttagggttcagcaagaaatccagtaatctg
tatctgatccaggtgacacacagcaacaacgaaacaagcctgacagaaaaatcatttgag
cagttttcaaaacttcacagccaacttcagaagcagtttgcatcactgactctcccagag
tttcctcattggtggcacctaccttttacaaattcagatcacagaagattcagagatcta
aatcattacatggaacagatattaaatgtatcacatgaagttacaaacagtgattgtgta
cttagctttttcctctctgaggctgtgcaacaaacagttgaagaatcatcacctgtgtac
ctaggtgagaagtttccagacaagaagcctaaggtgcagttagtcatatcctacgaggat
gtgaagctgaccatactagtgaaacacatgaaaaacattcatctcccagatggctctgcg
cccagtgcacatgttgaattttatcttttaccatatcccagtgaagttcgtaggaggaaa
acaaaatctgttccaaaatgtacggaccccacttacaatgaaattgtagtatatgatgaa
gtcacagagctccaaggacatgtcttaatgcttattgtgaagagtaaaactgtatttgtg
ggagcaattaacatccgactctgtagtgtcccactcgataaagaaaaatggtatccatta
ggaaacagtataatttga

DBGET integrated database retrieval system