KEGG   Homo sapiens (human): 5289Help
Entry
5289              CDS       T01001                                 

Gene name
PIK3C3, VPS34, hVps34
Definition
(RefSeq) phosphatidylinositol 3-kinase catalytic subunit type 3
  KO
K00914  
phosphatidylinositol 3-kinase [EC:2.7.1.137]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Autophagy - animal
Phagosome
Apelin signaling pathway
Tuberculosis
Drug target
Buparlisib (DG01823): 
Copanlisib (DG01926): 
Idelalisib: 
Safingol: 
Safingol hydrochloride: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5289 (PIK3C3)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    5289 (PIK3C3)
   04070 Phosphatidylinositol signaling system
    5289 (PIK3C3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    5289 (PIK3C3)
   04140 Autophagy - animal
    5289 (PIK3C3)
   04136 Autophagy - other eukaryotes
    5289 (PIK3C3)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    5289 (PIK3C3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.137  phosphatidylinositol 3-kinase
     5289 (PIK3C3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Macropinocytosis
   Kinases
    5289 (PIK3C3)
  Rab GTPases and associated proteins
   Rab associated proteins
    5289 (PIK3C3)
 Endosome - Lysosome transport
    5289 (PIK3C3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q8NEB9(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
18q12.3
AA seq 887 aa AA seqDB search
MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVT
CQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAV
PVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTK
AHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDG
DESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIV
SYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDV
EDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKK
DSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLI
SRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRS
LLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVK
IRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRK
ENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAE
VMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLN
KEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVK
KVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgggggaagcagagaagtttcactacatctatagttgtgacctggatatcaacgtccag
cttaagataggaagcttggaagggaagagagaacaaaagagttataaagctgtcctggaa
gacccaatgttgaagttctcaggactatatcaagagacatgctctgatctttatgttact
tgtcaagtttttgcagaagggaagcctttggccttgccagtgagaacatcctacaaagca
tttagtacaagatggaactggaatgaatggctgaaactaccagtaaaataccctgacctg
cccaggaatgcccaagtggccctcaccatatgggatgtgtatggtcccggaaaagcagtg
cctgtaggaggaacaacggtttcgctctttggaaaatacggcatgtttcgccaagggatg
catgacttgaaagtctggcctaatgtagaagcagatggatcagaacccacaaaaactcct
ggcagaacaagtagcactctctcagaagatcagatgagccgtcttgccaagctcaccaaa
gctcatcgacaaggacacatggtgaaagtagattggctggatagattgacatttagagaa
atagaaatgataaatgagagtgaaaaacgaagttctaatttcatgtacctgatggttgaa
tttcgatgtgtcaagtgtgatgataaggaatatggtattgtttattatgaaaaggacggt
gatgaatcatctccaattttaacaagttttgaattagtgaaagttcctgacccccagatg
tctatggagaatttagttgagagcaaacaccacaagcttgcccggagtttaagaagtgga
ccttctgaccacgatctgaaacccaatgctgccacgagagatcagttaaatattattgtg
agttatccaccaaccaagcaacttacatatgaagaacaagatcttgtttggaagtttaga
tattatcttacgaatcaagaaaaagccttgacaaaattcttgaaatgtgttaattgggat
ctacctcaagaggccaaacaggccttggaacttctgggaaaatggaagccgatggatgta
gaggactccttggagctgttatcctctcattacaccaacccaactgtgaggcgttatgct
gttgcccggttgcgacaggccgatgatgaggatttgttgatgtacctattacaattggtc
caggctctcaaatatgaaaattttgatgatataaagaatggattggaacctaccaagaag
gatagtcagagttcagtgtcagaaaatgtgtcaaattctggaataaattctgcagaaata
gatagctcccaaattataaccagcccccttccttcagtctcttcacctcctcctgcatca
aaaacaaaagaagttccagatggcgaaaatctggaacaagatctctgtaccttcttgata
tcgagagcctgcaaaaactcaacactggctaattatttatactggtatgtgatagtggaa
tgtgaagatcaagatactcagcagagagatccaaagacccatgagatgtacttgaacgta
atgagaagattcagccaagcattgttgaagggtgataagtctgtcagagttatgcgttct
ttgctggctgcacaacagacatttgtagatcggttggtgcatctaatgaaggcagtacaa
cgcgaaagtggaaatcgtaagaaaaagaatgagagactacaggcattgcttggagataat
gaaaagatgaatttgtcagatgtggaacttatcccgttgcctttagaaccccaagtgaaa
attagaggaataattccggaaacagctacactgtttaaaagtgcccttatgcctgcacag
ttgttttttaagacggaagatggaggcaaatatccagttatatttaagcatggagatgat
ttacgtcaagatcaacttattcttcaaatcatttcactcatggacaagctgttacggaaa
gaaaatctggacttgaaattgacaccttataaggtgttagccaccagtacaaaacatggc
ttcatgcagtttatccagtcagttcctgtggctgaagttcttgatacagagggaagcatt
cagaacttttttagaaaatatgcaccaagtgagaatgggccaaatgggattagtgctgag
gtcatggacacttacgttaaaagctgtgctggatattgcgtgatcacctatatacttgga
gttggagacaggcacctggataaccttttgctaacaaaaacaggcaaactcttccacata
gactttggatatattttgggtcgggatccaaagcctcttcctccaccaatgaagctgaat
aaagaaatggtagaaggaatggggggcacacagagtgagcagtaccaagagttccgtaaa
cagtgttacacggctttcctccacctgcgaaggtattctaatctgattttgaacttgttt
tccttgatggttgatgcaaacattccagatattgcacttgaaccagataaaactgtgaaa
aaggttcaggataaattccgcttagacctgtcggatgaagaggctgtgcattacatgcag
agtctgattgatgagagtgtccatgctctttttgctgcagtggtggaacagattcacaag
tttgcccagtactggagaaaatga

DBGET integrated database retrieval system