KEGG   Homo sapiens (human): 5294Help
Entry
5294              CDS       T01001                                 

Gene name
PIK3CG, PI3CG, PI3K, PI3Kgamma, PIK3, p110gamma, p120-PI3K
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
cGMP-PKG signaling pathway
Phospholipase D signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Platelet activation
Cholinergic synapse
Oxytocin signaling pathway
Toxoplasmosis
Kaposi's sarcoma-associated herpesvirus infection
Drug target
Dactolisib (DG01826): 
Duvelisib: 
Gedatolisib: 
Pictilisib: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5294 (PIK3CG)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    5294 (PIK3CG)
   04072 Phospholipase D signaling pathway
    5294 (PIK3CG)
   04022 cGMP - PKG signaling pathway
    5294 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    5294 (PIK3CG)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5294 (PIK3CG)
  Endocrine system
   04921 Oxytocin signaling pathway
    5294 (PIK3CG)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5294 (PIK3CG)
  Nervous system
   04725 Cholinergic synapse
    5294 (PIK3CG)
 Human Diseases
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    5294 (PIK3CG)
   05145 Toxoplasmosis
    5294 (PIK3CG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     5294 (PIK3CG)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    5294 (PIK3CG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P48736(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
7q22.3
AA seq 1102 aa AA seqDB search
MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLH
VAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLYQKKGQWYEIYDKYQVVQTLD
CLRYWKATHRSPGQIHLVQRHPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGL
VTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDT
PGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNG
EEIHVVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLQIYCGKAPALSSKASAESPSSESKGKVQLLYYVNLLLIDHRFLLRRGEY
VLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQKLENLQNSQLP
ESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atggagctggagaactataaacagcccgtggtgctgagagaggacaactgccgaaggcgc
cggaggatgaagccgcgcagtgctgcggccagcctgtcctccatggagctcatccccatc
gagttcgtgctgcccaccagccagcgcaaatgcaagagccccgaaacggcgctgctgcac
gtggccggccacggcaacgtggagcagatgaaggcccaggtgtggctgcgagcgctggag
accagcgtggcggcggacttctaccaccggctgggaccgcatcacttcctcctgctctat
cagaagaaggggcagtggtacgagatctacgacaagtaccaggtggtgcagactctggac
tgcctgcgctactggaaggccacgcaccggagcccgggccagatccacctggtgcagcgg
cacccgccctccgaggagtcccaagccttccagcggcagctcacggcgctgattggctat
gacgtcactgacgtcagcaacgtgcacgacgatgagctggagttcacgcgccgtggcttg
gtgaccccgcgcatggcggaggtggccagccgcgaccccaagctctacgccatgcacccg
tgggtgacgtccaagcccctcccggagtacctgtggaagaagattgccaacaactgcatc
ttcatcgtcattcaccgcagcaccaccagccagaccattaaggtctcacccgacgacacc
cccggcgccatcctgcagagcttcttcaccaagatggccaagaagaaatctctgatggat
attcccgaaagccaaagcgaacaggattttgtgctgcgcgtctgtggccgggatgagtac
ctggtgggcgaaacgcccatcaaaaacttccagtgggtgaggcactgcctcaagaacgga
gaagagattcacgtggtactggacacgcctccagacccggccctagacgaggtgaggaag
gaagagtggccactggtggatgactgcacgggagtcaccggctaccatgagcagcttacc
atccacggcaaggaccacgagagtgtgttcaccgtgtccctgtgggactgcgaccgcaag
ttcagggtcaagatcagaggcattgatatccccgtcctgcctcggaacaccgacctcaca
gtttttgtagaggcaaacatccagcatgggcaacaagtcctttgccaaaggagaaccagc
cccaaacccttcacagaggaggtgctgtggaatgtgtggcttgagttcagtatcaaaatc
aaagacttgcccaaaggggctctactgaacctccagatctactgcggtaaagctccagca
ctgtccagcaaggcctctgcagagtcccccagttctgagtccaagggcaaagttcagctt
ctctattatgtgaacctgctgctgatagaccaccgtttcctcctgcgccgtggagaatac
gtcctccacatgtggcagatatctgggaagggagaagaccaaggaagcttcaatgctgac
aaactcacgtctgcaactaacccagacaaggagaactcaatgtccatctccattcttctg
gacaattactgccacccgatagccctgcctaagcatcagcccacccctgacccggaaggg
gaccgggttcgagcagaaatgcccaaccagcttcgcaagcaattggaggcgatcatagcc
actgatccacttaaccctctcacagcagaggacaaagaattgctctggcattttagatac
gaaagccttaagcacccaaaagcatatcctaagctatttagttcagtgaaatggggacag
caagaaattgtggccaaaacataccaattgttggccagaagggaagtctgggatcaaagt
gctttggatgttgggttaacaatgcagctcctggactgcaacttctcagatgaaaatgta
agagccattgcagttcagaaactggagagcttggaggacgatgatgttctgcattacctt
ctacaattggtccaggctgtgaaatttgaaccataccatgatagcgcccttgccagattt
ctgctgaagcgtggtttaagaaacaaaagaattggtcactttttgttttggttcttgaga
agtgagatagcccagtccagacactatcagcagaggttcgctgtgattctggaagcctat
ctgaggggctgtggcacagccatgctgcacgactttacccaacaagtccaagtaatcgag
atgttacaaaaagtcacccttgatattaaatcgctctctgctgaaaagtatgacgtcagt
tcccaagttatttcacaacttaaacaaaagcttgaaaacctgcagaattctcaactcccc
gaaagctttagagttccatatgatcctggactgaaagcaggagcgctggcaattgaaaaa
tgtaaagtaatggcctccaagaaaaaaccactatggcttgagtttaaatgtgccgatcct
acagccctatcaaatgaaacaattggaattatctttaaacatggtgatgatctgcgccaa
gacatgcttattttacagattctacgaatcatggagtctatttgggagactgaatctttg
gatctatgcctcctgccatatggttgcatttcaactggtgacaaaataggaatgatcgag
attgtgaaagacgccacgacaattgccaaaattcagcaaagcacagtgggcaacacggga
gcatttaaagatgaagtcctgaatcactggctcaaagaaaaatcccctactgaagaaaag
tttcaggcagcagtggagagatttgtttattcctgtgcaggctactgtgtggcaaccttt
gttcttggaataggcgacagacacaatgacaatattatgatcaccgagacaggaaaccta
tttcatattgacttcgggcacattcttgggaattacaaaagtttcctgggcattaataaa
gagagagtgccatttgtgctaacccctgacttcctctttgtgatgggaacttctggaaag
aagacaagcccacacttccagaaatttcaggacatctgtgttaaggcttatctagccctt
cgtcatcacacaaacctactgatcatcctgttctccatgatgctgatgacaggaatgccc
cagttaacaagcaaagaagacattgaatatatccgggatgccctcacagtggggaaaaat
gaggaggatgctaaaaagtattttcttgatcagatcgaagtttgcagagacaaaggatgg
actgtgcagtttaattggtttctacatcttgttcttggcatcaaacaaggagagaaacat
tcagcctaa

DBGET integrated database retrieval system