KEGG   Homo sapiens (human): 5294Help
Entry
5294              CDS       T01001                                 

Gene name
PIK3CG, PI3CG, PI3K, PI3Kgamma, PIK3, p110gamma, p120-PI3K
Definition
phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma (EC:2.7.11.1 2.7.1.153)
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Signaling pathways regulating pluripotency of stem cells
Platelet activation
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Cholinergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Aldosterone-regulated sodium reabsorption
Carbohydrate digestion and absorption
Bacterial invasion of epithelial cells
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Amoebiasis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5294 (PIK3CG)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5294 (PIK3CG)
   04015 Rap1 signaling pathway
    5294 (PIK3CG)
   04012 ErbB signaling pathway
    5294 (PIK3CG)
   04370 VEGF signaling pathway
    5294 (PIK3CG)
   04630 Jak-STAT signaling pathway
    5294 (PIK3CG)
   04668 TNF signaling pathway
    5294 (PIK3CG)
   04066 HIF-1 signaling pathway
    5294 (PIK3CG)
   04068 FoxO signaling pathway
    5294 (PIK3CG)
   04070 Phosphatidylinositol signaling system
    5294 (PIK3CG)
   04024 cAMP signaling pathway
    5294 (PIK3CG)
   04022 cGMP - PKG signaling pathway
    5294 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    5294 (PIK3CG)
   04152 AMPK signaling pathway
    5294 (PIK3CG)
   04150 mTOR signaling pathway
    5294 (PIK3CG)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    5294 (PIK3CG)
  Cell growth and death
   04210 Apoptosis
    5294 (PIK3CG)
  Cellular commiunity
   04510 Focal adhesion
    5294 (PIK3CG)
   04550 Signaling pathways regulating pluripotency of stem cells
    5294 (PIK3CG)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5294 (PIK3CG)
   04620 Toll-like receptor signaling pathway
    5294 (PIK3CG)
   04650 Natural killer cell mediated cytotoxicity
    5294 (PIK3CG)
   04660 T cell receptor signaling pathway
    5294 (PIK3CG)
   04662 B cell receptor signaling pathway
    5294 (PIK3CG)
   04664 Fc epsilon RI signaling pathway
    5294 (PIK3CG)
   04666 Fc gamma R-mediated phagocytosis
    5294 (PIK3CG)
   04670 Leukocyte transendothelial migration
    5294 (PIK3CG)
   04062 Chemokine signaling pathway
    5294 (PIK3CG)
  Endocrine system
   04910 Insulin signaling pathway
    5294 (PIK3CG)
   04915 Estrogen signaling pathway
    5294 (PIK3CG)
   04914 Progesterone-mediated oocyte maturation
    5294 (PIK3CG)
   04917 Prolactin signaling pathway
    5294 (PIK3CG)
   04921 Oxytocin signaling pathway
    5294 (PIK3CG)
   04919 Thyroid hormone signaling pathway
    5294 (PIK3CG)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5294 (PIK3CG)
  Digestive system
   04973 Carbohydrate digestion and absorption
    5294 (PIK3CG)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    5294 (PIK3CG)
  Nervous system
   04725 Cholinergic synapse
    5294 (PIK3CG)
   04722 Neurotrophin signaling pathway
    5294 (PIK3CG)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5294 (PIK3CG)
  Development
   04380 Osteoclast differentiation
    5294 (PIK3CG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5294 (PIK3CG)
   05205 Proteoglycans in cancer
    5294 (PIK3CG)
   05203 Viral carcinogenesis
    5294 (PIK3CG)
   05210 Colorectal cancer
    5294 (PIK3CG)
   05212 Pancreatic cancer
    5294 (PIK3CG)
   05214 Glioma
    5294 (PIK3CG)
   05221 Acute myeloid leukemia
    5294 (PIK3CG)
   05220 Chronic myeloid leukemia
    5294 (PIK3CG)
   05218 Melanoma
    5294 (PIK3CG)
   05211 Renal cell carcinoma
    5294 (PIK3CG)
   05215 Prostate cancer
    5294 (PIK3CG)
   05213 Endometrial cancer
    5294 (PIK3CG)
   05222 Small cell lung cancer
    5294 (PIK3CG)
   05223 Non-small cell lung cancer
    5294 (PIK3CG)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    5294 (PIK3CG)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5294 (PIK3CG)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    5294 (PIK3CG)
   05166 HTLV-I infection
    5294 (PIK3CG)
   05162 Measles
    5294 (PIK3CG)
   05164 Influenza A
    5294 (PIK3CG)
   05161 Hepatitis B
    5294 (PIK3CG)
   05160 Hepatitis C
    5294 (PIK3CG)
   05169 Epstein-Barr virus infection
    5294 (PIK3CG)
   05146 Amoebiasis
    5294 (PIK3CG)
   05145 Toxoplasmosis
    5294 (PIK3CG)
   05142 Chagas disease (American trypanosomiasis)
    5294 (PIK3CG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     5294 (PIK3CG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q22.3
AA seq 1102 aa AA seqDB search
MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLH
VAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLYQKKGQWYEIYDKYQVVQTLD
CLRYWKATHRSPGQIHLVQRHPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGL
VTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDT
PGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNG
EEIHVVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLQIYCGKAPALSSKASAESPSSESKGKVQLLYYVNLLLIDHRFLLRRGEY
VLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQKLENLQNSQLP
ESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atggagctggagaactataaacagcccgtggtgctgagagaggacaactgccgaaggcgc
cggaggatgaagccgcgcagtgctgcggccagcctgtcctccatggagctcatccccatc
gagttcgtgctgcccaccagccagcgcaaatgcaagagccccgaaacggcgctgctgcac
gtggccggccacggcaacgtggagcagatgaaggcccaggtgtggctgcgagcgctggag
accagcgtggcggcggacttctaccaccggctgggaccgcatcacttcctcctgctctat
cagaagaaggggcagtggtacgagatctacgacaagtaccaggtggtgcagactctggac
tgcctgcgctactggaaggccacgcaccggagcccgggccagatccacctggtgcagcgg
cacccgccctccgaggagtcccaagccttccagcggcagctcacggcgctgattggctat
gacgtcactgacgtcagcaacgtgcacgacgatgagctggagttcacgcgccgtggcttg
gtgaccccgcgcatggcggaggtggccagccgcgaccccaagctctacgccatgcacccg
tgggtgacgtccaagcccctcccggagtacctgtggaagaagattgccaacaactgcatc
ttcatcgtcattcaccgcagcaccaccagccagaccattaaggtctcacccgacgacacc
cccggcgccatcctgcagagcttcttcaccaagatggccaagaagaaatctctgatggat
attcccgaaagccaaagcgaacaggattttgtgctgcgcgtctgtggccgggatgagtac
ctggtgggcgaaacgcccatcaaaaacttccagtgggtgaggcactgcctcaagaacgga
gaagagattcacgtggtactggacacgcctccagacccggccctagacgaggtgaggaag
gaagagtggccactggtggatgactgcacgggagtcaccggctaccatgagcagcttacc
atccacggcaaggaccacgagagtgtgttcaccgtgtccctgtgggactgcgaccgcaag
ttcagggtcaagatcagaggcattgatatccccgtcctgcctcggaacaccgacctcaca
gtttttgtagaggcaaacatccagcatgggcaacaagtcctttgccaaaggagaaccagc
cccaaacccttcacagaggaggtgctgtggaatgtgtggcttgagttcagtatcaaaatc
aaagacttgcccaaaggggctctactgaacctccagatctactgcggtaaagctccagca
ctgtccagcaaggcctctgcagagtcccccagttctgagtccaagggcaaagttcagctt
ctctattatgtgaacctgctgctgatagaccaccgtttcctcctgcgccgtggagaatac
gtcctccacatgtggcagatatctgggaagggagaagaccaaggaagcttcaatgctgac
aaactcacgtctgcaactaacccagacaaggagaactcaatgtccatctccattcttctg
gacaattactgccacccgatagccctgcctaagcatcagcccacccctgacccggaaggg
gaccgggttcgagcagaaatgcccaaccagcttcgcaagcaattggaggcgatcatagcc
actgatccacttaaccctctcacagcagaggacaaagaattgctctggcattttagatac
gaaagccttaagcacccaaaagcatatcctaagctatttagttcagtgaaatggggacag
caagaaattgtggccaaaacataccaattgttggccagaagggaagtctgggatcaaagt
gctttggatgttgggttaacaatgcagctcctggactgcaacttctcagatgaaaatgta
agagccattgcagttcagaaactggagagcttggaggacgatgatgttctgcattacctt
ctacaattggtccaggctgtgaaatttgaaccataccatgatagcgcccttgccagattt
ctgctgaagcgtggtttaagaaacaaaagaattggtcactttttgttttggttcttgaga
agtgagatagcccagtccagacactatcagcagaggttcgctgtgattctggaagcctat
ctgaggggctgtggcacagccatgctgcacgactttacccaacaagtccaagtaatcgag
atgttacaaaaagtcacccttgatattaaatcgctctctgctgaaaagtatgacgtcagt
tcccaagttatttcacaacttaaacaaaagcttgaaaacctgcagaattctcaactcccc
gaaagctttagagttccatatgatcctggactgaaagcaggagcgctggcaattgaaaaa
tgtaaagtaatggcctccaagaaaaaaccactatggcttgagtttaaatgtgccgatcct
acagccctatcaaatgaaacaattggaattatctttaaacatggtgatgatctgcgccaa
gacatgcttattttacagattctacgaatcatggagtctatttgggagactgaatctttg
gatctatgcctcctgccatatggttgcatttcaactggtgacaaaataggaatgatcgag
attgtgaaagacgccacgacaattgccaaaattcagcaaagcacagtgggcaacacggga
gcatttaaagatgaagtcctgaatcactggctcaaagaaaaatcccctactgaagaaaag
tttcaggcagcagtggagagatttgtttattcctgtgcaggctactgtgtggcaaccttt
gttcttggaataggcgacagacacaatgacaatattatgatcaccgagacaggaaaccta
tttcatattgacttcgggcacattcttgggaattacaaaagtttcctgggcattaataaa
gagagagtgccatttgtgctaacccctgacttcctctttgtgatgggaacttctggaaag
aagacaagcccacacttccagaaatttcaggacatctgtgttaaggcttatctagccctt
cgtcatcacacaaacctactgatcatcctgttctccatgatgctgatgacaggaatgccc
cagttaacaagcaaagaagacattgaatatatccgggatgccctcacagtggggaaaaat
gaggaggatgctaaaaagtattttcttgatcagatcgaagtttgcagagacaaaggatgg
actgtgcagtttaattggtttctacatcttgttcttggcatcaaacaaggagagaaacat
tcagcctaa

DBGET integrated database retrieval system