KEGG   Homo sapiens (human): 5294Help
Entry
5294              CDS       T01001                                 

Gene name
PIK3CG, PI3CG, PI3K, PI3Kgamma, PIK3, p110gamma, p120-PI3K
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa04022  cGMP-PKG signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04371  Apelin signaling pathway
hsa04611  Platelet activation
hsa04725  Cholinergic synapse
hsa04921  Oxytocin signaling pathway
hsa05145  Toxoplasmosis
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
Network
N00153  CXCR-GNB/G-PI3K-JNK signaling pathway
N00154  CXCR-GNB/G-PI3K-AKT signaling pathway
N00158  KSHV vGPCR to GNB/G-PI3K-AKT signaling pathway
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
Drug target
Duvelisib: D10555
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5294 (PIK3CG)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    5294 (PIK3CG)
   04072 Phospholipase D signaling pathway
    5294 (PIK3CG)
   04022 cGMP - PKG signaling pathway
    5294 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    5294 (PIK3CG)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5294 (PIK3CG)
  Endocrine system
   04921 Oxytocin signaling pathway
    5294 (PIK3CG)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5294 (PIK3CG)
  Nervous system
   04725 Cholinergic synapse
    5294 (PIK3CG)
 Human Diseases
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    5294 (PIK3CG)
   05145 Toxoplasmosis
    5294 (PIK3CG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     5294 (PIK3CG)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    5294 (PIK3CG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135 DUF3244
Motif
Other DBs
NCBI-GeneID: 5294
NCBI-ProteinID: NP_001269355
OMIM: 601232
HGNC: 8978
Ensembl: ENSG00000105851
Vega: OTTHUMG00000157641
Pharos: P48736(Tchem)
UniProt: P48736 A0A024R720 A8K9G9
Structure
PDB: 

Jmol
Position
7q22.3
AA seq 1102 aa AA seqDB search
MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLH
VAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLYQKKGQWYEIYDKYQVVQTLD
CLRYWKATHRSPGQIHLVQRHPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGL
VTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDT
PGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNG
EEIHVVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLQIYCGKAPALSSKASAESPSSESKGKVQLLYYVNLLLIDHRFLLRRGEY
VLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQKLENLQNSQLP
ESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atggagctggagaactataaacagcccgtggtgctgagagaggacaactgccgaaggcgc
cggaggatgaagccgcgcagtgctgcggccagcctgtcctccatggagctcatccccatc
gagttcgtgctgcccaccagccagcgcaaatgcaagagccccgaaacggcgctgctgcac
gtggccggccacggcaacgtggagcagatgaaggcccaggtgtggctgcgagcgctggag
accagcgtggcggcggacttctaccaccggctgggaccgcatcacttcctcctgctctat
cagaagaaggggcagtggtacgagatctacgacaagtaccaggtggtgcagactctggac
tgcctgcgctactggaaggccacgcaccggagcccgggccagatccacctggtgcagcgg
cacccgccctccgaggagtcccaagccttccagcggcagctcacggcgctgattggctat
gacgtcactgacgtcagcaacgtgcacgacgatgagctggagttcacgcgccgtggcttg
gtgaccccgcgcatggcggaggtggccagccgcgaccccaagctctacgccatgcacccg
tgggtgacgtccaagcccctcccggagtacctgtggaagaagattgccaacaactgcatc
ttcatcgtcattcaccgcagcaccaccagccagaccattaaggtctcacccgacgacacc
cccggcgccatcctgcagagcttcttcaccaagatggccaagaagaaatctctgatggat
attcccgaaagccaaagcgaacaggattttgtgctgcgcgtctgtggccgggatgagtac
ctggtgggcgaaacgcccatcaaaaacttccagtgggtgaggcactgcctcaagaacgga
gaagagattcacgtggtactggacacgcctccagacccggccctagacgaggtgaggaag
gaagagtggccactggtggatgactgcacgggagtcaccggctaccatgagcagcttacc
atccacggcaaggaccacgagagtgtgttcaccgtgtccctgtgggactgcgaccgcaag
ttcagggtcaagatcagaggcattgatatccccgtcctgcctcggaacaccgacctcaca
gtttttgtagaggcaaacatccagcatgggcaacaagtcctttgccaaaggagaaccagc
cccaaacccttcacagaggaggtgctgtggaatgtgtggcttgagttcagtatcaaaatc
aaagacttgcccaaaggggctctactgaacctccagatctactgcggtaaagctccagca
ctgtccagcaaggcctctgcagagtcccccagttctgagtccaagggcaaagttcagctt
ctctattatgtgaacctgctgctgatagaccaccgtttcctcctgcgccgtggagaatac
gtcctccacatgtggcagatatctgggaagggagaagaccaaggaagcttcaatgctgac
aaactcacgtctgcaactaacccagacaaggagaactcaatgtccatctccattcttctg
gacaattactgccacccgatagccctgcctaagcatcagcccacccctgacccggaaggg
gaccgggttcgagcagaaatgcccaaccagcttcgcaagcaattggaggcgatcatagcc
actgatccacttaaccctctcacagcagaggacaaagaattgctctggcattttagatac
gaaagccttaagcacccaaaagcatatcctaagctatttagttcagtgaaatggggacag
caagaaattgtggccaaaacataccaattgttggccagaagggaagtctgggatcaaagt
gctttggatgttgggttaacaatgcagctcctggactgcaacttctcagatgaaaatgta
agagccattgcagttcagaaactggagagcttggaggacgatgatgttctgcattacctt
ctacaattggtccaggctgtgaaatttgaaccataccatgatagcgcccttgccagattt
ctgctgaagcgtggtttaagaaacaaaagaattggtcactttttgttttggttcttgaga
agtgagatagcccagtccagacactatcagcagaggttcgctgtgattctggaagcctat
ctgaggggctgtggcacagccatgctgcacgactttacccaacaagtccaagtaatcgag
atgttacaaaaagtcacccttgatattaaatcgctctctgctgaaaagtatgacgtcagt
tcccaagttatttcacaacttaaacaaaagcttgaaaacctgcagaattctcaactcccc
gaaagctttagagttccatatgatcctggactgaaagcaggagcgctggcaattgaaaaa
tgtaaagtaatggcctccaagaaaaaaccactatggcttgagtttaaatgtgccgatcct
acagccctatcaaatgaaacaattggaattatctttaaacatggtgatgatctgcgccaa
gacatgcttattttacagattctacgaatcatggagtctatttgggagactgaatctttg
gatctatgcctcctgccatatggttgcatttcaactggtgacaaaataggaatgatcgag
attgtgaaagacgccacgacaattgccaaaattcagcaaagcacagtgggcaacacggga
gcatttaaagatgaagtcctgaatcactggctcaaagaaaaatcccctactgaagaaaag
tttcaggcagcagtggagagatttgtttattcctgtgcaggctactgtgtggcaaccttt
gttcttggaataggcgacagacacaatgacaatattatgatcaccgagacaggaaaccta
tttcatattgacttcgggcacattcttgggaattacaaaagtttcctgggcattaataaa
gagagagtgccatttgtgctaacccctgacttcctctttgtgatgggaacttctggaaag
aagacaagcccacacttccagaaatttcaggacatctgtgttaaggcttatctagccctt
cgtcatcacacaaacctactgatcatcctgttctccatgatgctgatgacaggaatgccc
cagttaacaagcaaagaagacattgaatatatccgggatgccctcacagtggggaaaaat
gaggaggatgctaaaaagtattttcttgatcagatcgaagtttgcagagacaaaggatgg
actgtgcagtttaattggtttctacatcttgttcttggcatcaaacaaggagagaaacat
tcagcctaa

DBGET integrated database retrieval system