KEGG   Homo sapiens (human): 5319Help
Entry
5319              CDS       T01001                                 

Gene name
PLA2G1B, PLA2, PLA2A, PPLA2
Definition
phospholipase A2, group IB (pancreas) (EC:3.1.1.4)
Orthology
K01047  
secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Vascular smooth muscle contraction
Pancreatic secretion
Fat digestion and absorption
Drug target
Orlistat: 
Meclofenamic acid: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    5319 (PLA2G1B)
   00565 Ether lipid metabolism
    5319 (PLA2G1B)
   00590 Arachidonic acid metabolism
    5319 (PLA2G1B)
   00591 Linoleic acid metabolism
    5319 (PLA2G1B)
   00592 alpha-Linolenic acid metabolism
    5319 (PLA2G1B)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5319 (PLA2G1B)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    5319 (PLA2G1B)
  Digestive system
   04972 Pancreatic secretion
    5319 (PLA2G1B)
   04975 Fat digestion and absorption
    5319 (PLA2G1B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     5319 (PLA2G1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.31
AA seq 148 aa AA seqDB search
MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPV
DELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNC
DRNAAICFSKAPYNKAHKNLDTKKYCQS
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccttgtgctagctgtgctgctcacagtggccgccgccgacagcggcatcagc
cctcgggccgtgtggcagttccgcaaaatgatcaagtgcgtgatcccggggagtgacccc
ttcttggaatacaacaactacggctgctactgtggcttggggggctcaggcacccccgtg
gatgaactggacaagtgctgccagacacatgacaactgctatgaccaggccaagaagctg
gacagctgtaaatttctgctggacaacccgtacacccacacctattcatactcgtgctct
ggctcggcaatcacctgtagcagcaaaaacaaagagtgtgaggccttcatttgcaactgc
gaccgcaacgctgccatctgcttttcaaaagctccatataacaaggcacacaagaacctg
gacaccaagaagtattgtcagagttga

DBGET integrated database retrieval system