KEGG   Homo sapiens (human): 5320Help
Entry
5320              CDS       T01001                                 

Gene name
PLA2G2A, MOM1, PLA2, PLA2B, PLA2L, PLA2S, PLAS1, sPLA2
Definition
phospholipase A2, group IIA (platelets, synovial fluid) (EC:3.1.1.4)
Orthology
K01047  
secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Vascular smooth muscle contraction
Pancreatic secretion
Fat digestion and absorption
Drug target
Orlistat: 
Meclofenamic acid: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    5320 (PLA2G2A)
   00565 Ether lipid metabolism
    5320 (PLA2G2A)
   00590 Arachidonic acid metabolism
    5320 (PLA2G2A)
   00591 Linoleic acid metabolism
    5320 (PLA2G2A)
   00592 alpha-Linolenic acid metabolism
    5320 (PLA2G2A)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5320 (PLA2G2A)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    5320 (PLA2G2A)
  Digestive system
   04972 Pancreatic secretion
    5320 (PLA2G2A)
   04975 Fat digestion and absorption
    5320 (PLA2G2A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     5320 (PLA2G2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p35
AA seq 144 aa AA seqDB search
MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDAT
DRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFAR
NKTTYNKKYQYYSNKHCRGSTPRC
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccctcctactgttggcagtgatcatgatctttggcctactgcaggcccatggg
aatttggtgaatttccacagaatgatcaagttgacgacaggaaaggaagccgcactcagt
tatggcttctacggctgccactgtggcgtgggtggcagaggatcccccaaggatgcaacg
gatcgctgctgtgtcactcatgactgttgctacaaacgtctggagaaacgtggatgtggc
accaaatttctgagctacaagtttagcaactcggggagcagaatcacctgtgcaaaacag
gactcctgcagaagtcaactgtgtgagtgtgataaggctgctgccacctgttttgctaga
aacaagacgacctacaataaaaagtaccagtactattccaataaacactgcagagggagc
acccctcgttgctga

DBGET integrated database retrieval system