KEGG   Homo sapiens (human): 5322Help
Entry
5322              CDS       T01001                                 

Gene name
PLA2G5, FRFB, GV-PLA2, PLA2-10, hVPLA(2)
Definition
(RefSeq) phospholipase A2 group V
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283 D08107 D08221
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    5322 (PLA2G5)
   00565 Ether lipid metabolism
    5322 (PLA2G5)
   00590 Arachidonic acid metabolism
    5322 (PLA2G5)
   00591 Linoleic acid metabolism
    5322 (PLA2G5)
   00592 alpha-Linolenic acid metabolism
    5322 (PLA2G5)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5322 (PLA2G5)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    5322 (PLA2G5)
  Digestive system
   04972 Pancreatic secretion
    5322 (PLA2G5)
   04975 Fat digestion and absorption
    5322 (PLA2G5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     5322 (PLA2G5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    5322 (PLA2G5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholip_A2_1 Phospholip_A2_2
Motif
Other DBs
NCBI-GeneID: 5322
NCBI-ProteinID: NP_000920
OMIM: 601192
HGNC: 9038
Ensembl: ENSG00000127472
Vega: OTTHUMG00000002698
Pharos: P39877(Tchem)
UniProt: P39877
Position
1p36.13
AA seq 138 aa AA seqDB search
MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGT
DWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKR
NLRSYNPQYQYFPNILCS
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcctcctcccactggcttggttcctggcttgtagtgtgcctgctgtgcaagga
ggcttgctggacctaaaatcaatgatcgagaaggtgacagggaagaacgccctgacaaac
tacggcttctacggctgttactgcggctggggcggccgaggaacccccaaggatggcacc
gattggtgctgttgggcgcatgaccactgctatgggcggctggaggagaagggctgcaac
attcgcacacagtcctacaaatacagattcgcgtggggcgtggtcacctgcgagcccggg
cccttctgccatgtgaacctctgtgcctgtgaccggaagctcgtctactgcctcaagaga
aacctacggagctacaacccacagtaccaatactttcccaacatcctctgctcctag

DBGET integrated database retrieval system