KEGG   Homo sapiens (human): 5322Help
Entry
5322              CDS       T01001                                 

Gene name
PLA2G5, FRFB, GV-PLA2, PLA2-10, hVPLA(2)
Definition
phospholipase A2, group V (EC:3.1.1.4)
Orthology
K01047  
secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Vascular smooth muscle contraction
Pancreatic secretion
Fat digestion and absorption
Drug target
Orlistat: 
Meclofenamic acid: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    5322 (PLA2G5)
   00565 Ether lipid metabolism
    5322 (PLA2G5)
   00590 Arachidonic acid metabolism
    5322 (PLA2G5)
   00591 Linoleic acid metabolism
    5322 (PLA2G5)
   00592 alpha-Linolenic acid metabolism
    5322 (PLA2G5)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5322 (PLA2G5)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    5322 (PLA2G5)
  Digestive system
   04972 Pancreatic secretion
    5322 (PLA2G5)
   04975 Fat digestion and absorption
    5322 (PLA2G5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     5322 (PLA2G5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
1p36-p34
AA seq 138 aa AA seqDB search
MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGT
DWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKR
NLRSYNPQYQYFPNILCS
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcctcctcccactggcttggttcctggcttgtagtgtgcctgctgtgcaagga
ggcttgctggacctaaaatcaatgatcgagaaggtgacagggaagaacgccctgacaaac
tacggcttctacggctgttactgcggctggggcggccgaggaacccccaaggatggcacc
gattggtgctgttgggcgcatgaccactgctatgggcggctggaggagaagggctgcaac
attcgcacacagtcctacaaatacagattcgcgtggggcgtggtcacctgcgagcccggg
cccttctgccatgtgaacctctgtgcctgtgaccggaagctcgtctactgcctcaagaga
aacctacggagctacaacccacagtaccaatactttcccaacatcctctgctcctag

DBGET integrated database retrieval system