KEGG   Homo sapiens (human): 5330Help
Entry
5330              CDS       T01001                                 

Gene name
PLCB2, PLC-beta-2
Definition
phospholipase C, beta 2 (EC:3.1.4.11)
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Chemokine signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Carbohydrate digestion and absorption
Alzheimer's disease
Huntington's disease
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Amoebiasis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5330 (PLCB2)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    5330 (PLCB2)
   04310 Wnt signaling pathway
    5330 (PLCB2)
   04020 Calcium signaling pathway
    5330 (PLCB2)
   04070 Phosphatidylinositol signaling system
    5330 (PLCB2)
   04022 cGMP - PKG signaling pathway
    5330 (PLCB2)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    5330 (PLCB2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5330 (PLCB2)
   04062 Chemokine signaling pathway
    5330 (PLCB2)
  Endocrine system
   04911 Insulin secretion
    5330 (PLCB2)
   04912 GnRH signaling pathway
    5330 (PLCB2)
   04915 Estrogen signaling pathway
    5330 (PLCB2)
   04921 Oxytocin signaling pathway
    5330 (PLCB2)
   04918 Thyroid hormone synthesis
    5330 (PLCB2)
   04919 Thyroid hormone signaling pathway
    5330 (PLCB2)
   04916 Melanogenesis
    5330 (PLCB2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5330 (PLCB2)
   04270 Vascular smooth muscle contraction
    5330 (PLCB2)
  Digestive system
   04970 Salivary secretion
    5330 (PLCB2)
   04971 Gastric acid secretion
    5330 (PLCB2)
   04972 Pancreatic secretion
    5330 (PLCB2)
   04973 Carbohydrate digestion and absorption
    5330 (PLCB2)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    5330 (PLCB2)
  Nervous system
   04724 Glutamatergic synapse
    5330 (PLCB2)
   04725 Cholinergic synapse
    5330 (PLCB2)
   04728 Dopaminergic synapse
    5330 (PLCB2)
   04726 Serotonergic synapse
    5330 (PLCB2)
   04720 Long-term potentiation
    5330 (PLCB2)
   04730 Long-term depression
    5330 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    5330 (PLCB2)
  Sensory system
   04742 Taste transduction
    5330 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    5330 (PLCB2)
  Environmental adaptation
   04713 Circadian entrainment
    5330 (PLCB2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    5330 (PLCB2)
   05016 Huntington's disease
    5330 (PLCB2)
  Infectious diseases
   05146 Amoebiasis
    5330 (PLCB2)
   05142 Chagas disease (American trypanosomiasis)
    5330 (PLCB2)
   05143 African trypanosomiasis
    5330 (PLCB2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     5330 (PLCB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q15
AA seq 1181 aa AA seqDB search
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKAWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPEPVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINAQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKM
AEYCRTIFGDMLLTEPLEKFPLKPGVPLPSPEDLRGKILIKNKKNQFSGPTSSSKDTGGE
AEGSSPPSAPAVWAGEEGTELEEEEVEEEEEEESGNLDEEEIKKMQSDEGTAGLEVTAYE
EMSSLVNYIQPTKFVSFEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQMSRIY
PKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMAVFEFNGQSGYLLKHEFMRRP
DKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRTKLSP
STNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHLCLHS
ESNMPLTMPALFIFLEMKDYIPGAWADLTVALANPIKFFSAHDTKSVKLKEAMGGLPEKP
FPLASPVASQVNGALAPTSNGSPAARAGAREEAMKEAAEPRTASLEELRELKGVVKLQRR
HEKELRELERRGARRWEELLQRGAAQLAELGPPGVGGVGACKLGPGKGSRKKRSLPREES
AGAAPGEGPEGVDGRVRELKDRLELELLRQGEEQYECVLKRKEQHVAEQISKMMELAREK
QAAELKALKETSENDTKEMKKKLETKRLERIQGMTKVTTDKMAQERLKREINNSHIQEVV
QVIKQMTENLERHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKESVRA
CLRTCFPSEAKDKPERACECPPELCEQDPLIAKADAQESRL
NT seq 3546 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgctcaaccctgtcctgctgccccccaaggtgaaggcctatctgagccaaggg
gagcgcttcatcaaatgggatgatgaaactacagttgcctctccagttatcctccgtgtg
gatcctaagggctactacttatactggacgtatcaaagtaaggagatggagtttctggat
atcaccagcatccgggatactcgctttgggaagtttgccaagatgcccaagagccagaag
ctccgggacgtcttcaacatggactttcctgataacagtttcctgctgaagacactcacg
gtggtgtccggcccggacatggtggacctcaccttccacaacttcgtctcctacaaggag
aacgtgggcaaggcctgggctgaggacgtactggccctagtcaaacatccgctgacggcc
aacgcctcccgcagcaccttcctggacaagatccttgtgaagctcaagatgcagctcaac
tctgaagggaagattccggtgaagaactttttccagatgtttcctgctgaccgcaagcgg
gtggaagctgctctcagtgcctgccacctccccaaaggcaaaaatgacgccatcaatcct
gaggacttcccagaacctgtctacaagagtttcctcatgagcctctgtcctcggccagaa
atagatgagatcttcacttcttaccatgctaaggccaaaccctacatgacgaaggagcac
ctgaccaaattcatcaaccagaaacagcgggactcccggcttaactccctgctgttcccg
ccagcacggcctgaccaggtgcagggcctcatcgacaagtatgagcccagtggcatcaat
gcacagaggggccagctgtcacctgaaggcatggtctggtttctctgtgggccagagaac
agcgtgctggcccaggacaagctgctgctccaccacgacatgacgcagccactcaatcat
tacttcatcaactcgtcccacaacacctacctgacagccggccagttctcaggcctctcc
tcggctgagatgtaccgccaggtgctgctctctggctgccgttgcgtggagctagactgc
tggaaggggaaaccccctgacgaggagcccattatcacccatggcttcaccatgaccaca
gacatcttcttcaaagaagcaattgaggctattgcagaaagcgcctttaagacctccccc
tatcccatcatcctgtcgtttgagaaccatgtggactcaccccgccagcaggctaagatg
gctgagtattgccggacgatctttggggatatgctgctcacagagcccctggaaaagttc
ccactaaaaccaggtgtccccctgcccagccctgaggatctcaggggcaagatcctcatc
aagaacaagaagaaccagttttctggccccacctcctccagtaaggatactggtggggag
gctgagggcagcagcccacccagtgcccctgcagtgtgggctggcgaggaagggactgag
ctggaggaggaggaggtggaagaggaagaggaggaggagtcaggaaacctggatgaagaa
gagattaagaagatgcagtcggatgagggcacagcgggcctggaagtgacggcttatgag
gagatgtccagcctagtcaattacatccagcccaccaagttcgtctcctttgagttctct
gcccaaaagaaccgaagttatgtcatctcgtccttcacagagctcaaggcatatgacctg
ctctccaaggcctcggtgcagtttgtggactacaacaagcgccagatgagccgcatttac
cccaagggaacccgcatggactcctccaactacatgccccagatgttctggaatgctgga
tgccagatggttgccctcaacttccagacgatggacttgcccatgcagcagaacatggca
gtatttgagttcaacgggcagagcggctacctcctcaagcatgagttcatgcgccggccg
gacaagcagttcaaccccttctcagtggaccgcatcgacgtggtggtggccaccaccctt
tccattacggtgatctctgggcagttcctgtcagaacgcagcgtgcgcacctatgtagaa
gtggagctgtttggccttcctggggaccccaagaggcgctatcgaactaagctgtcaccc
agtactaactccatcaatcctgtctggaaggaggagccctttgtctttgagaagatcttg
atgcctgagctggcctccctcagagtggctgtgatggaggaaggcaacaagtttcttgga
caccgcatcatccccatcaatgccctaaattctgggtaccaccacctgtgcctgcacagt
gagagcaacatgcccctcaccatgcctgcgctcttcatcttcctggagatgaaggactac
atacctggtgcttgggcagatctcactgtggccctcgccaaccccattaagttcttcagt
gcccatgacacgaagtctgtgaagctcaaggaggccatgggaggtctgcctgagaagccc
ttcccactggcgagtccagttgccagccaggtcaatggggcgttggccccaacgagcaat
gggtcaccagcagccagggccggggccagggaagaggctatgaaagaagctgcggagccg
cggaccgccagcctggaggagctccgggagctaaagggcgtggtgaagctgcagcggcgg
cacgagaaggagctgcgagagttggagcggcgcggagcgcggcgctgggaggagctgctg
cagcggggcgcggcgcagctggcggagctcgggccaccgggcgtggggggcgtcggggcc
tgcaagctcggtcccggcaagggctctcgcaagaagaggagcctgccccgcgaggagagc
gccggagccgcgccgggcgagggccctgagggcgtggacgggcgcgtgcgggagctgaaa
gacaggctggagctggagctgctgcggcagggcgaggagcagtacgagtgcgttctgaag
cgcaaggagcagcacgtggccgagcaaatctccaaaatgatggagctggccagagagaaa
caggcggcagagctgaaggccctgaaggagacgtcggagaacgacaccaaagagatgaag
aaaaagctggagacaaagagactggagcggatccagggcatgaccaaagtcaccacagac
aagatggcccaggagaggttgaagagagagattaacaactcccacatccaggaagtagtg
caggtgatcaagcagatgacggagaacttggagaggcaccaggagaagctggaggagaag
caggcggcttgcctggaacagatacgggagatggaaaagcagttccagaaggaggcgctg
gcagagtacgaggccaggatgaagggtctggaggcagaggtgaaggagtcggtgagggcc
tgcctcaggacctgctttccctccgaggccaaggacaagcctgagagggcctgcgagtgc
cccccagagctgtgtgagcaggacccactcatagcaaaggcagatgcccaggagagccgc
ctctga

DBGET integrated database retrieval system