KEGG   Homo sapiens (human): 53358Help
Entry
53358             CDS       T01001                                 

Gene name
SHC3, N-Shc, NSHC, RAI, SHCC
Definition
SHC (Src homology 2 domain containing) transforming protein 3
Orthology
K17448  
SHC- transforming protein 3
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Ras signaling pathway
Chemokine signaling pathway
Focal adhesion
Natural killer cell mediated cytotoxicity
Neurotrophin signaling pathway
Insulin signaling pathway
Estrogen signaling pathway
Prolactin signaling pathway
Alcoholism
Bacterial invasion of epithelial cells
Glioma
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    53358 (SHC3)
   04012 ErbB signaling pathway
    53358 (SHC3)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    53358 (SHC3)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    53358 (SHC3)
   04062 Chemokine signaling pathway
    53358 (SHC3)
  Endocrine system
   04910 Insulin signaling pathway
    53358 (SHC3)
   04915 Estrogen signaling pathway
    53358 (SHC3)
   04917 Prolactin signaling pathway
    53358 (SHC3)
  Nervous system
   04722 Neurotrophin signaling pathway
    53358 (SHC3)
 Human Diseases
  Cancers
   05214 Glioma
    53358 (SHC3)
   05220 Chronic myeloid leukemia
    53358 (SHC3)
  Substance dependence
   05034 Alcoholism
    53358 (SHC3)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    53358 (SHC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
9q22.1
AA seq 594 aa AA seqDB search
MLPRTKYNRFRNDSVTSVDDLLHSLSVSGGGGKVSAARATPAAAPYLVSGEALRKAPDDG
PGSLGHLLHKVSHLKLSSSGLRGLSSAARERAGARLSGSCSAPSLAAPDGSAPSAPRAPA
MSAARKGRPGDEPLPRPPRGAPHASDQVLGPGVTYVVKYLGCIEVLRSMRSLDFSTRTQI
TREAISRVCEAVPGAKGAFKKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPD
SKQIIANHHMRSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQA
FELRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSDHPYYNSIPSKMPPPGGFLDTRL
KPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYSTPEGKLHVAPTGE
APTYVNTQQIPPQAWPAAVSSAESSPRKDLFDMKPFEDALKNQPLGPVLSKAASVECISP
VSPRAPDAKMLEELQAETWYQGEMSRKEAEGLLEKDGDFLVRKSTTNPGSFVLTGMHNGQ
AKHLLLVDPEGTIRTKDRVFDSISHLINHHLESSLPIVSAGSELCLQQPVERKQ
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgcttccacgcaccaagtataaccgcttcaggaatgactcggtgacatcggtcgatgac
cttctccacagcctgtcggtgagcggcggcggaggcaaggtttcggcggcgcgcgcgacc
ccggcggcggctccctacttggtgtccggcgaggcgctgcgcaaggcgcccgacgatggg
cccggcagcctgggccacctgctccacaaggtgtcccacctgaaactctccagctcgggc
ctccgcggcctgtcgtcggccgcccgggagcgggcgggcgcgcggctctcgggcagctgc
agcgcgcccagcctggccgccccggacggcagtgcgccctcggcgccccgcgccccggcc
atgagcgccgccaggaagggccggcccggcgacgagccgctgcccaggccccctcggggg
gcgccgcacgccagcgaccaggtgctggggcccggagtcacctacgtggtcaagtacttg
gggtgcattgaagttctgcgctcaatgaggtctcttgacttcagtacaagaacacaaatt
accagggaagccatcagccgcgtctgtgaagctgtgcctggtgcgaagggagccttcaag
aagagaaagcctccaagcaaaatgctgtccagcatcttgggaaagagcaacctccagttt
gcgggaatgagcatctctctgaccatctccacggccagtctgaacctgcgaactccggac
tccaaacagatcatagcgaatcaccacatgcggtccatctccttcgcctctgggggagac
ccggacacaactgactatgttgcatatgtggctaaggaccctgttaatcgcagagcttgt
cacattttggaatgctgtgatgggctggcccaggatgtcatcggctccatcggacaagcc
tttgagctccggtttaagcaatatttacagtgtcctaccaagattcccgctctccatgat
cgaatgcagagtctggatgagccatggacggaagaggagggagatggctcagaccaccca
tactacaacagcatcccaagcaagatgcctcctccagggggctttcttgatactagactg
aaacccagaccccatgctcctgacacagcccagtttgcaggaaaagagcagacttattac
cagggaagacacttaggagacacttttggcgaagactggcagcaaacacctttaaggcaa
gggtcctcggacatctacagcacgccagaagggaaactgcacgtggcccccacgggagaa
gcacccacctacgtcaacactcagcagatcccaccacaggcctggccggctgcggtcagc
agtgctgagagcagcccaaggaaagacctctttgacatgaaaccttttgaagatgctctc
aagaaccagcccttggggcccgtgttaagcaaggcagcctccgtggagtgcatcagccct
gtgtcacctagagccccagatgccaagatgctggaggaactgcaagccgagacttggtac
caaggagagatgagcaggaaggaggcagaggggctgctggagaaagacggagacttcctg
gtcaggaagagcaccaccaacccgggctcctttgtcctcacgggcatgcacaatggccag
gccaagcacctgctgctcgtggacccagaaggcacgatccggacaaaggacagagtcttt
gacagtatcagccacctcatcaaccaccacctagaaagcagcctgcccattgtctctgca
gggagtgagctgtgtctccagcagccagtggagaggaagcagtga

DBGET integrated database retrieval system