KEGG   Homo sapiens (human): 53632Help
Entry
53632             CDS       T01001                                 

Gene name
PRKAG3, AMPKG3
Definition
protein kinase, AMP-activated, gamma 3 non-catalytic subunit
Orthology
K07200  
5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
AMPK signaling pathway
Circadian rhythm
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    53632 (PRKAG3)
   04152 AMPK signaling pathway
    53632 (PRKAG3)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    53632 (PRKAG3)
   04920 Adipocytokine signaling pathway
    53632 (PRKAG3)
   04921 Oxytocin signaling pathway
    53632 (PRKAG3)
  Environmental adaptation
   04710 Circadian rhythm
    53632 (PRKAG3)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    53632 (PRKAG3)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    53632 (PRKAG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q35
AA seq 489 aa AA seqDB search
MEPGLEHALRRTPSWSSLGGSEHQEMSFLEQENSSSWPSPAVTSSSERIRGKRRAKALRW
TRQKSVEEGEPPGQGEGPRSRPAAESTGLEATFPKTTPLAQADPAGVGTPPTGWDCLPSD
CTASAAGSSTDDVELATEFPATEAWECELEGLLEERPALCLSPQAPFPKLGWDDELRKPG
AQIYMRFMQEHTCYDAMATSSKLVIFDTMLEIKKAFFALVANGVRAAPLWDSKKQSFVGM
LTITDFILVLHRYYRSPLVQIYEIEQHKIETWREIYLQGCFKPLVSISPNDSLFEAVYTL
IKNRIHRLPVLDPVSGNVLHILTHKRLLKFLHIFGSLLPRPSFLYRTIQDLGIGTFRDLA
VVLETAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEA
LRQRTLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQALVLS
PAGIDALGA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgggctggagcacgcactgcgcaggaccccttcctggagcagccttgggggt
tctgagcatcaagagatgagcttcctagagcaagaaaacagcagctcatggccatcacca
gctgtgaccagcagctcagaaagaatccgtgggaaacggagggccaaagccttgagatgg
acaaggcagaagtcggtggaggaaggggagccaccaggtcagggggaaggtccccggtcc
aggccagctgctgagtccaccgggctggaggccacattccccaagaccacacccttggct
caagctgatcctgccggggtgggcactccaccaacagggtgggactgcctcccctctgac
tgtacagcctcagctgcaggctccagcacagatgatgtggagctggccacggagttccca
gccacagaggcctgggagtgtgagctagaaggcctgctggaagagaggcctgccctgtgc
ctgtccccgcaggccccatttcccaagctgggctgggatgacgaactgcggaaacccggc
gcccagatctacatgcgcttcatgcaggagcacacctgctacgatgccatggcaactagc
tccaagctagtcatcttcgacaccatgctggagatcaagaaggccttctttgctctggtg
gccaacggtgtgcgggcagcccctctatgggacagcaagaagcagagctttgtggggatg
ctgaccatcactgacttcatcctggtgctgcatcgctactacaggtcccccctggtccag
atctatgagattgaacaacataagattgagacctggagggagatctacctgcaaggctgc
ttcaagcctctggtctccatctctcctaatgatagcctgtttgaagctgtctacaccctc
atcaagaaccggatccatcgcctgcctgttcttgacccggtgtcaggcaacgtactccac
atcctcacacacaaacgcctgctcaagttcctgcacatctttggttccctgctgccccgg
ccctccttcctctaccgcactatccaagatttgggcatcggcacattccgagacttggct
gtggtgctggagacagcacccatcctgactgcactggacatctttgtggaccggcgtgtg
tctgcactgcctgtggtcaacgaatgtggtcaggtcgtgggcctctattcccgctttgat
gtgattcacctggctgcccagcaaacctacaaccacctggacatgagtgtgggagaagcc
ctgaggcagaggacactatgtctggagggagtcctttcctgccagccccacgagagcttg
ggggaagtgatcgacaggattgctcgggagcaggtacacaggctggtgctagtggacgag
acccagcatctcttgggcgtggtctccctctccgacatccttcaggcactggtgctcagc
cctgctggcatcgatgccctcggggcctga

DBGET integrated database retrieval system