KEGG   Homo sapiens (human): 53632Help
Entry
53632             CDS       T01001                                 

Gene name
PRKAG3, AMPKG3
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 3
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04710  Circadian rhythm
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    53632 (PRKAG3)
   04068 FoxO signaling pathway
    53632 (PRKAG3)
   04152 AMPK signaling pathway
    53632 (PRKAG3)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    53632 (PRKAG3)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    53632 (PRKAG3)
   04922 Glucagon signaling pathway
    53632 (PRKAG3)
   04920 Adipocytokine signaling pathway
    53632 (PRKAG3)
   04921 Oxytocin signaling pathway
    53632 (PRKAG3)
  Aging
   04211 Longevity regulating pathway - mammal
    53632 (PRKAG3)
   04213 Longevity regulating pathway - multiple species
    53632 (PRKAG3)
  Environmental adaptation
   04710 Circadian rhythm
    53632 (PRKAG3)
   04714 Thermogenesis
    53632 (PRKAG3)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    53632 (PRKAG3)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    53632 (PRKAG3)
   04931 Insulin resistance
    53632 (PRKAG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS
Motif
Other DBs
NCBI-GeneID: 53632
NCBI-ProteinID: NP_059127
OMIM: 604976
HGNC: 9387
Ensembl: ENSG00000115592
Vega: OTTHUMG00000133078
Pharos: Q9UGI9(Tbio)
UniProt: Q9UGI9 A0A024R426
Position
2q35
AA seq 489 aa AA seqDB search
MEPGLEHALRRTPSWSSLGGSEHQEMSFLEQENSSSWPSPAVTSSSERIRGKRRAKALRW
TRQKSVEEGEPPGQGEGPRSRPAAESTGLEATFPKTTPLAQADPAGVGTPPTGWDCLPSD
CTASAAGSSTDDVELATEFPATEAWECELEGLLEERPALCLSPQAPFPKLGWDDELRKPG
AQIYMRFMQEHTCYDAMATSSKLVIFDTMLEIKKAFFALVANGVRAAPLWDSKKQSFVGM
LTITDFILVLHRYYRSPLVQIYEIEQHKIETWREIYLQGCFKPLVSISPNDSLFEAVYTL
IKNRIHRLPVLDPVSGNVLHILTHKRLLKFLHIFGSLLPRPSFLYRTIQDLGIGTFRDLA
VVLETAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEA
LRQRTLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQALVLS
PAGIDALGA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgggctggagcacgcactgcgcaggaccccttcctggagcagccttgggggt
tctgagcatcaagagatgagcttcctagagcaagaaaacagcagctcatggccatcacca
gctgtgaccagcagctcagaaagaatccgtgggaaacggagggccaaagccttgagatgg
acaaggcagaagtcggtggaggaaggggagccaccaggtcagggggaaggtccccggtcc
aggccagctgctgagtccaccgggctggaggccacattccccaagaccacacccttggct
caagctgatcctgccggggtgggcactccaccaacagggtgggactgcctcccctctgac
tgtacagcctcagctgcaggctccagcacagatgatgtggagctggccacggagttccca
gccacagaggcctgggagtgtgagctagaaggcctgctggaagagaggcctgccctgtgc
ctgtccccgcaggccccatttcccaagctgggctgggatgacgaactgcggaaacccggc
gcccagatctacatgcgcttcatgcaggagcacacctgctacgatgccatggcaactagc
tccaagctagtcatcttcgacaccatgctggagatcaagaaggccttctttgctctggtg
gccaacggtgtgcgggcagcccctctatgggacagcaagaagcagagctttgtggggatg
ctgaccatcactgacttcatcctggtgctgcatcgctactacaggtcccccctggtccag
atctatgagattgaacaacataagattgagacctggagggagatctacctgcaaggctgc
ttcaagcctctggtctccatctctcctaatgatagcctgtttgaagctgtctacaccctc
atcaagaaccggatccatcgcctgcctgttcttgacccggtgtcaggcaacgtactccac
atcctcacacacaaacgcctgctcaagttcctgcacatctttggttccctgctgccccgg
ccctccttcctctaccgcactatccaagatttgggcatcggcacattccgagacttggct
gtggtgctggagacagcacccatcctgactgcactggacatctttgtggaccggcgtgtg
tctgcactgcctgtggtcaacgaatgtggtcaggtcgtgggcctctattcccgctttgat
gtgattcacctggctgcccagcaaacctacaaccacctggacatgagtgtgggagaagcc
ctgaggcagaggacactatgtctggagggagtcctttcctgccagccccacgagagcttg
ggggaagtgatcgacaggattgctcgggagcaggtacacaggctggtgctagtggacgag
acccagcatctcttgggcgtggtctccctctccgacatccttcaggcactggtgctcagc
cctgctggcatcgatgccctcggggcctga

DBGET integrated database retrieval system