KEGG   Homo sapiens (human): 5371Help
Entry
5371              CDS       T01001                                 

Gene name
PML, MYL, PP8675, RNF71, TRIM19
Definition
promyelocytic leukemia
Orthology
K10054  
probable transcription factor PML
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Endocytosis
Influenza A
Herpes simplex infection
Pathways in cancer
Transcriptional misregulation in cancer
Acute myeloid leukemia
Disease
H00003  
Acute myeloid leukemia (AML)
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Cancers; Acute myeloid leukemia [PATH:hsa05221]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q22
AA seq 633 aa AA seqDB search
MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQC
QAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYR
QIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDG
TRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEEL
DAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEA
VDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLR
QEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPE
EAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCS
QTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLP
NSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENL
ADPQAEDRPLVFFDLKIDNESGFSWGYPHPFLI
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggagcctgcacccgcccgatctccgaggccccagcaggaccccgcccggccccaggag
cccaccatgcctccccccgagaccccctctgaaggccgccagcccagccccagccccagc
cctacagagcgagcccccgcttcggaggaggagttccagtttctgcgctgccagcaatgc
caggcggaagccaagtgcccgaagctgctgccttgtctgcacacgctgtgctcaggatgc
ctggaggcgtcgggcatgcagtgccccatctgccaggcgccctggcccctaggtgcagac
acacccgccctggataacgtctttttcgagagtctgcagcggcgcctgtcggtgtaccgg
cagattgtggatgcgcaggctgtgtgcacccgctgcaaagagtcggccgacttctggtgc
tttgagtgcgagcagctcctctgcgccaagtgcttcgaggcacaccagtggttcctcaag
cacgaggcccggcccctagcagagctgcgcaaccagtcggtgcgtgagttcctggacggc
acccgcaagaccaacaacatcttctgctccaaccccaaccaccgcacccctacgctgacc
agcatctactgccgaggatgttccaagccgctgtgctgctcgtgcgcgctccttgacagc
agccacagtgagctcaagtgcgacatcagcgcagagatccagcagcgacaggaggagctg
gacgccatgacgcaggcgctgcaggagcaggatagtgcctttggcgcggttcacgcgcag
atgcacgcggccgtcggccagctgggccgcgcgcgtgccgagaccgaggagctgatccgc
gagcgcgtgcgccaggtggtagctcacgtgcgggctcaggagcgcgagctgctggaggct
gtggacgcgcggtaccagcgcgactacgaggagatggccagtcggctgggccgcctggat
gctgtgctgcagcgcatccgcacgggcagcgcgctggtgcagaggatgaagtgctacgcc
tcggaccaggaggtgctggacatgcacggtttcctgcgccaggcgctctgccgcctgcgc
caggaggagccccagagcctgcaagctgccgtgcgcaccgatggcttcgacgagttcaag
gtgcgcctgcaggacctcagctcttgcatcacccaggggaaagatgcagctgtatccaag
aaagccagcccagaggctgccagcactcccagggaccctattgacgttgacctgcccgag
gaggcagagagagtgaaggcccaggttcaggccctggggctggctgaagcccagcctatg
gctgtggtacagtcagtgcccggggcacaccccgtgccagtgtacgccttctccatcaaa
ggcccttcctatggagaggatgtctccaatacaacgacagcccagaagaggaagtgcagc
cagacccagtgccccaggaaggtcatcaagatggagtctgaggaggggaaggaggcaagg
ttggctcggagctccccggagcagcccaggcccagcacctccaaggcagtctcaccaccc
cacctggatggaccgcctagccccaggagccccgtcataggaagtgaggtcttcctgccc
aacagcaaccacgtggccagtggcgccggggaggcagaggaacgcgttgtggtgatcagc
agctcggaagactcagatgccgaaaactcgtcctcccgagagctggatgacagcagcagt
gagtccagtgacctccagctggaaggccccagcaccctcagggtcctggacgagaacctt
gctgacccccaagcagaagacagacctctggttttctttgacctcaagattgacaatgaa
agtgggttctcctggggctacccccacccctttctaatttag

DBGET integrated database retrieval system