KEGG   Homo sapiens (human): 5407Help
Entry
5407              CDS       T01001                                 

Gene name
PNLIPRP1, PLRP1
Definition
(RefSeq) pancreatic lipase related protein 1
  KO
K14074  pancreatic lipase-related protein 1 [EC:3.1.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Module
hsa_M00098  Acylglycerol degradation
Drug target
Orlistat: D04028
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    5407 (PNLIPRP1)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    5407 (PNLIPRP1)
   04975 Fat digestion and absorption
    5407 (PNLIPRP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     5407 (PNLIPRP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase PLAT Abhydrolase_6 Abhydrolase_3 Abhydrolase_1 Lipase_3 DUF900 LIDHydrolase DUF676
Motif
Other DBs
NCBI-GeneID: 5407
NCBI-ProteinID: NP_001290064
OMIM: 604422
HGNC: 9156
Ensembl: ENSG00000187021
Vega: OTTHUMG00000019109
Pharos: P54315(Tbio)
UniProt: P54315
Structure
PDB: 

Jmol
Position
10q25.3
AA seq 467 aa AA seqDB search
MLIFWTITLFLLGAAKGKEVCYEDLGCFSDTEPWGGTAIRPLKILPWSPEKIGTRFLLYT
NENPNNFQILLLSDPSTIEASNFQMDRKTRFIIHGFIDKGDESWVTDMCKKLFEVEEVNC
ICVDWKKGSQATYTQAANNVRVVGAQVAQMLDILLTEYSYPPSKVHLIGHSLGAHVAGEA
GSKTPGLSRITGLDPVEASFESTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQQMG
HLDFFPNGGESMPGCKKNALSQIVDLDGIWAGTRDFVACNHLRSYKYYLESILNPDGFAA
YPCTSYKSFESDKCFPCPDQGCPQMGHYADKFAGRTSEEQQKFFLNTGEASNFARWRYGV
SITLSGRTATGQIKVALFGNKGNTHQYSIFRGILKPGSTHSYEFDAKLDVGTIEKVKFLW
NNNVINPTLPKVGATKITVQKGEEKTVYNFCSEDTVREDTLLTLTPC
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcttctggacaatcacacttttcctgctgggagcagccaaaggaaaagaagtt
tgctatgaggacctcgggtgcttttctgacactgagccctggggcgggacagcaatcagg
cccctgaaaattctcccctggagccctgagaagatcggcacccgcttcctgctgtacacc
aatgaaaacccaaacaactttcaaattctcctcctctctgatccatcaacaattgaggca
tcaaattttcaaatggacagaaagacccggttcatcatccatggcttcatagacaaagga
gatgagagctgggtgacagacatgtgcaagaaactgttcgaggtggaggaggtgaactgc
atctgcgtggactggaagaagggctcccaagccacctacacacaggctgccaacaacgtg
cgagtggtgggcgcccaggtggcccagatgctcgacatcctcttgacagagtatagctac
cccccttccaaagttcacctcattggccacagcctgggagcccacgtggctggagaggca
ggaagcaagactccaggcctgagcaggattacagggttggatcctgtagaagcaagtttc
gagagtactcctgaagaggtgcgacttgatccctctgatgctgactttgttgatgtgatt
cacacggatgcagctcccctgatcccattcttgggttttggaacgaaccaacagatgggt
catcttgacttcttccccaatggaggagagagcatgccgggatgcaagaagaatgccctg
tctcagatcgtggatctagatggcatctgggcgggaacccgggactttgtggcttgcaat
cacctaagaagctacaagtattacttggaaagcatcctcaatcccgatgggtttgctgca
tatccctgcacttcctacaagtcctttgagtctgacaagtgcttcccgtgtccagatcaa
ggatgcccacagatgggtcactatgctgataaatttgctggcaggacaagtgaagagcag
cagaaattcttcttgaacacaggagaggctagcaatttcgctcgctggagatatggggtt
tccatcacactgtctggaagaacagccactggtcagatcaaagttgctttgtttggaaat
aagggaaacactcaccagtacagtatcttcagggggattctcaaaccaggctcaacccat
tcctatgagtttgatgcaaagctggatgttggaacaattgagaaagtcaagtttctttgg
aataacaatgtgataaatccaaccctccccaaagtgggtgccaccaagatcactgtgcaa
aagggagaagagaagacagtgtacaacttctgtagcgaagacacagtgcgggaagacacg
ctgctcaccctcacgccctgctaa

DBGET integrated database retrieval system