KEGG   Homo sapiens (human): 5407Help
Entry
5407              CDS       T01001                                 

Gene name
PNLIPRP1, PLRP1
Definition
pancreatic lipase-related protein 1 (EC:3.1.1.3)
Orthology
K14074  
pancreatic lipase-related protein 1 [EC:3.1.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Metabolic pathways
Pancreatic secretion
Fat digestion and absorption
Module
Acylglycerol degradation
Drug target
Orlistat: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    5407 (PNLIPRP1)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    5407 (PNLIPRP1)
   04975 Fat digestion and absorption
    5407 (PNLIPRP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     5407 (PNLIPRP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q25.3
AA seq 467 aa AA seqDB search
MLIFWTITLFLLGAAKGKEVCYEDLGCFSDTEPWGGTAIRPLKILPWSPEKIGTRFLLYT
NENPNNFQILLLSDPSTIEASNFQMDRKTRFIIHGFIDKGDESWVTDMCKKLFEVEEVNC
ICVDWKKGSQATYTQAANNVRVVGAQVAQMLDILLTEYSYPPSKVHLIGHSLGAHVAGEA
GSKTPGLSRITGLDPVEASFESTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQQMG
HLDFFPNGGESMPGCKKNALSQIVDLDGIWAGTRDFVACNHLRSYKYYLESILNPDGFAA
YPCTSYKSFESDKCFPCPDQGCPQMGHYADKFAGRTSEEQQKFFLNTGEASNFARWRYGV
SITLSGRTATGQIKVALFGNKGNTHQYSIFRGILKPGSTHSYEFDAKLDVGTIEKVKFLW
NNNVINPTLPKVGATKITVQKGEEKTVYNFCSEDTVREDTLLTLTPC
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcttctggacaatcacacttttcctgctgggagcagccaaaggaaaagaagtt
tgctatgaggacctcgggtgcttttctgacactgagccctggggcgggacagcaatcagg
cccctgaaaattctcccctggagccctgagaagatcggcacccgcttcctgctgtacacc
aatgaaaacccaaacaactttcaaattctcctcctctctgatccatcaacaattgaggca
tcaaattttcaaatggacagaaagacccggttcatcatccatggcttcatagacaaagga
gatgagagctgggtgacagacatgtgcaagaaactgttcgaggtggaggaggtgaactgc
atctgcgtggactggaagaagggctcccaagccacctacacacaggctgccaacaacgtg
cgagtggtgggcgcccaggtggcccagatgctcgacatcctcttgacagagtatagctac
cccccttccaaagttcacctcattggccacagcctgggagcccacgtggctggagaggca
ggaagcaagactccaggcctgagcaggattacagggttggatcctgtagaagcaagtttc
gagagtactcctgaagaggtgcgacttgatccctctgatgctgactttgttgatgtgatt
cacacggatgcagctcccctgatcccattcttgggttttggaacgaaccaacagatgggt
catcttgacttcttccccaatggaggagagagcatgccgggatgcaagaagaatgccctg
tctcagatcgtggatctagatggcatctgggcgggaacccgggactttgtggcttgcaat
cacctaagaagctacaagtattacttggaaagcatcctcaatcccgatgggtttgctgca
tatccctgcacttcctacaagtcctttgagtctgacaagtgcttcccgtgtccagatcaa
ggatgcccacagatgggtcactatgctgataaatttgctggcaggacaagtgaagagcag
cagaaattcttcttgaacacaggagaggctagcaatttcgctcgctggagatatggggtt
tccatcacactgtctggaagaacagccactggtcagatcaaagttgctttgtttggaaat
aagggaaacactcaccagtacagcatcttcagggggattctcaaaccaggctcaacccat
tcctatgagtttgatgcaaagctggatgttggaacaattgagaaagtcaagtttctttgg
aataacaatgtgataaatccaaccctccccaaagtgggtgccaccaagatcactgtgcaa
aagggagaagagaagacagtgtacaacttctgtagcgaagacacagtgcgggaagacacg
ctgctcaccctcacgccctgctaa

DBGET integrated database retrieval system