KEGG   Homo sapiens (human): 54205Help
Entry
54205             CDS       T01001                                 

Gene name
CYCS, CYC, HCS, THC4
Definition
cytochrome c, somatic
Orthology
K08738  
cytochrome c
Organism
hsa  Homo sapiens (human)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Toxoplasmosis
Tuberculosis
Hepatitis B
Influenza A
Herpes simplex infection
Pathways in cancer
Colorectal cancer
Small cell lung cancer
Viral myocarditis
Disease
H00978  
Thrombocytopenia (THC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    54205 (CYCS)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    54205 (CYCS)
   04115 p53 signaling pathway
    54205 (CYCS)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    54205 (CYCS)
   05210 Colorectal cancer
    54205 (CYCS)
   05222 Small cell lung cancer
    54205 (CYCS)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    54205 (CYCS)
   05012 Parkinson's disease
    54205 (CYCS)
   05014 Amyotrophic lateral sclerosis (ALS)
    54205 (CYCS)
   05016 Huntington's disease
    54205 (CYCS)
  Cardiovascular diseases
   05416 Viral myocarditis
    54205 (CYCS)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    54205 (CYCS)
  Infectious diseases
   05134 Legionellosis
    54205 (CYCS)
   05152 Tuberculosis
    54205 (CYCS)
   05164 Influenza A
    54205 (CYCS)
   05161 Hepatitis B
    54205 (CYCS)
   05168 Herpes simplex infection
    54205 (CYCS)
   05145 Toxoplasmosis
    54205 (CYCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p15.3
AA seq 105 aa AA seqDB search
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcccagtgccacacc
gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctctttgggcggaag
acaggtcaggcccctggatactcttacacagccgccaataagaacaaaggcatcatctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgtcggcattaagaagaaggaagaaagggcagacttaatagcttatctcaaa
aaagctactaatgagtaa

DBGET integrated database retrieval system