KEGG   Homo sapiens (human): 5430Help
Entry
5430              CDS       T01001                                 

Gene name
POLR2A, POLR2, POLRA, RPB1, RPBh1, RPO2, RPOL2, RpIILS, hRPB220, hsRPB1
Definition
(RefSeq) RNA polymerase II subunit A
  KO
K03006  
DNA-directed RNA polymerase II subunit RPB1 [EC:2.7.7.6]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Huntington's disease
Herpes simplex infection
Epstein-Barr virus infection
Module
RNA polymerase II, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    5430 (POLR2A)
   00240 Pyrimidine metabolism
    5430 (POLR2A)
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    5430 (POLR2A)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    5430 (POLR2A)
  Infectious diseases
   05168 Herpes simplex infection
    5430 (POLR2A)
   05169 Epstein-Barr virus infection
    5430 (POLR2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     5430 (POLR2A)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     5430 (POLR2A)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5430 (POLR2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p13.1
AA seq 1970 aa AA seqDB search
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT
SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKY
SPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN
NT seq 5913 nt NT seq  +upstreamnt  +downstreamnt
atgcacgggggtggccccccctcgggggacagcgcatgcccgctgcgcaccatcaagaga
gtccagttcggagtcctgagtccggatgaactgaagcgaatgtctgtgacggagggtggc
atcaaatacccagagacgactgagggaggccgccccaagcttggggggctgatggacccg
aggcagggggtgattgagcggactggccgctgccaaacatgtgcaggaaacatgacagag
tgtcctggccactttggccacattgaactggccaagcctgtgtttcacgtgggcttcctg
gtgaagacaatgaaagttttgcgctgtgtctgcttcttctgctccaaactgcttgtggac
tctaacaacccaaagatcaaggatatcctggctaagtccaagggacagcccaagaagcgg
ctcacacatgtctacgacctttgcaagggcaaaaacatatgcgagggtggggaggagatg
gacaacaagttcggtgtggaacaacctgagggtgacgaggatctgaccaaagaaaagggc
catggtggctgtgggcggtaccagcccaggatccggcgttctggcctagagctgtatgcg
gaatggaagcacgttaatgaggactctcaggagaagaagatcctgctgagtccagagcga
gtgcatgagatcttcaaacgcatctcagatgaggagtgttttgtgctgggcatggagccc
cgctatgcacggccagagtggatgattgtcacagtgctgcctgtgcccccgctctccgtg
cggcctgctgttgtgatgcagggctctgcccgtaaccaggatgacctgactcacaaactg
gctgacatcgtgaagatcaacaatcagctgcggcgcaatgagcagaacggcgcagcggcc
catgtcattgcagaggatgtgaagctcctccagttccatgtggccaccatggtggacaat
gagctgcctggcttgccccgtgccatgcagaagtctgggcgtcccctcaagtccctgaag
cagcggttgaagggcaaggaaggccgggtgcgagggaacctgatgggcaaaagagtggac
ttctcggcccgtactgtcatcacccccgaccccaacctctccattgaccaggttggcgtg
ccccgctccattgctgccaacatgacctttgcggagattgtcacccccttcaacattgac
agacttcaagaactagtgcgcagggggaacagccagtacccaggcgccaagtacatcatc
cgagacaatggtgatcgcattgacttgcgtttccaccccaagcccagtgaccttcacctg
cagaccggctataaggtggaacggcacatgtgtgatggggacattgttatcttcaaccgg
cagccaactctgcacaaaatgtccatgatggggcatcgggtccgcattctcccatggtct
acctttcgcttgaatcttagtgtgacaactccgtacaatgcagactttgacggggatgag
atgaacttgcacctgccacagtctctggagacgcgagcagagatccaggagctggccatg
gttcctcgcatgattgtcaccccccagagcaatcggcctgtcatgggtattgtgcaggac
acactcacagcagtgcgcaaattcaccaagagagacgtcttcctggagcggggtgaagtg
atgaacctcctgatgttcctgtcgacgtgggatgggaaggtcccacagccggccatccta
aagccccggcccctgtggacaggcaagcaaatcttctccctcatcatacctggtcacatc
aattgtatccgtacccacagcacccatcccgatgatgaagacagtggcccttacaagcac
atctctcctggggacaccaaggtggtggtggagaatggggagctgatcatgggcatcctg
tgtaagaagtctctgggcacgtcagctggctccctggtccacatctcctacctagagatg
ggtcatgacatcactcgcctcttctactccaacattcagactgtcattaacaactggctc
ctcatcgagggtcatactattggcattggggactccattgctgattctaagacttaccag
gacattcagaacactattaagaaggccaagcaggacgtaatagaggtcatcgagaaggca
cacaacaatgagctggagcccaccccagggaacactctgcggcagacgtttgagaatcag
gtgaaccgcattcttaacgatgcccgagacaagactggctcctctgctcagaaatccctg
tctgaatacaacaacttcaagtctatggtcgtgtccggagctaaaggttccaagattaac
atctcccaggtcattgctgtcgttggacagcagaacgtcgagggcaagcggattccattt
ggcttcaagcaccggactctgcctcacttcatcaaggatgactacgggcctgagagccgt
ggctttgtggagaactcctacctagccggcctcacacccactgagttctttttccacgcc
atggggggtcgtgaggggctcattgacacggctgtcaagactgctgagactggatacatc
cagcggcggctgatcaagtccatggagtcagtgatggtgaagtacgacgcgactgtgcgg
aactccatcaaccaggtggtgcagctgcgctacggcgaagacggcctggcaggcgagagc
gttgagttccagaacctggctacgcttaagccttccaacaaggcttttgagaagaagttc
cgctttgattataccaatgagagggccctgcggcgcactctgcaggaggacctggtgaag
gacgtgctgagcaacgcacacatccagaacgagttggagcgggaatttgagcggatgcgg
gaggatcgggaggtgctcagggtcatcttcccaactggagacagcaaggtcgtcctcccc
tgtaacctgctgcggatgatctggaatgctcagaaaatcttccacatcaacccacgcctt
ccctccgacctgcaccccatcaaagtggtggagggagtcaaggaattgagcaagaagctg
gtgattgtgaatggggatgacccactaagtcgacaggcccaggaaaatgccacgctgctc
ttcaacatccacctgcggtccacgttgtgttcccgccgcatggcagaggagtttcggctc
agtggggaggccttcgactggctgcttggggagattgagtccaagttcaaccaagccatt
gcgcatcccggggaaatggtgggggctctggctgcgcagtcccttggagaacctgccacc
cagatgaccttgaataccttccactatgctggtgtgtctgccaagaatgtgacgctgggt
gtgccccgacttaaggagctcatcaacatttccaagaagccaaagactccttcgcttact
gtcttcctgttgggccagtccgctcgagatgctgagagagccaaggatattctgtgccgt
ctggagcatacaacgttgaggaaggtgactgccaacacagccatctactatgaccccaac
ccccagagcacggtggtggcagaggatcaggaatgggtgaatgtctactatgaaatgcct
gactttgatgtggcccgaatctccccctggctgttgcgggtggagctggatcggaagcac
atgactgaccggaagctcaccatggagcagattgctgaaaagatcaatgctggttttggt
gacgacttgaactgcatctttaatgatgacaatgcagagaagctggtgctccgtattcgc
atcatgaacagcgatgagaacaagatgcaagaggaggaagaggtggtggacaagatggat
gatgatgtcttcctgcgctgcatcgagtccaacatgctgacagatatgaccctgcagggc
atcgagcagatcagcaaggtgtacatgcacttgccacagacagacaacaagaagaagatc
atcatcacggaggatggggaattcaaggccctgcaggagtggatcctggagacggacggc
gtgagcttgatgcgggtgctgagtgagaaggacgtggaccccgtacgcaccacgtccaat
gacattgtggagatcttcacggtgctgggcattgaagccgtgcggaaggccctggagcgg
gagctgtaccacgtcatctcctttgatggctcctatgtcaattaccgacacttggctctc
ttgtgtgataccatgacctgtcgtggccacttgatggccatcacccgacacggagtcaac
cgccaggacacaggaccactcatgaagtgttcctttgaggaaacggtggacgtgcttatg
gaagcagccgcacacggtgagagtgaccccatgaagggggtctctgagaatatcatgctg
ggccagctggctccggccggcactggctgctttgacctcctgcttgatgcagagaagtgc
aagtatggcatggagatccccaccaatatccccggcctgggggctgctggacccaccggc
atgttctttggttcagcacccagtcccatgggtggaatctctcctgccatgacaccttgg
aaccagggtgcaacccctgcctatggcgcctggtcccccagtgttgggagtggaatgacc
ccaggggcagccggcttctctcccagtgctgcgtcagatgccagcggcttcagcccaggt
tactcccctgcctggtctcccacaccgggctccccggggtccccaggtccctcaagcccc
tacatcccttcaccaggtggtgccatgtctcccagctactcgccaacgtcacctgcctac
gagccccgctctcctgggggctacacaccccagagtccctcttattcccccacttcaccc
tcctactcccctacctctccatcctattctccaaccagtcccaactatagtcccacatca
cccagctattcgccaacgtcacccagctactcaccgacctctcccagctactcacccacc
tctcccagctactcgcccacctctcccagctactcgcccacctctcccagctactcaccc
acttcccctagctactcgcccacttcccctagctactcgccaacgtctcccagctactcg
ccgacatctcccagctactcgccaacttcacccagctattctcccacttctcccagctac
tcacctacctctccaagctattcacccacctcccccagctactcacccacttccccaagt
tactcacccaccagcccgaactattctccaaccagtcccaattacaccccaacatcaccc
agctacagcccgacatcacccagctattcacctactagtcccaactacacacctaccagc
cctaactacagcccaacctctccaagctactctccaacatcacccagctattccccgacc
tcaccaagttactccccttccagcccacgatacacaccacagtctccaacctatacccca
agctcacccagctacagccccagctcgcccagctacagcccaacctcacccaagtacacc
ccaaccagtccttcttacagtcccagctccccagagtataccccaacctctcccaagtac
tcacctaccagtcccaaatattcacccacctctcccaagtactcgcctaccagtcccacc
tattcacccaccaccccaaaatactccccaacatctcctacttattccccaacctctcca
gtctacaccccaacctctcccaagtactcacctactagccccacttactcgcccacttcc
cccaagtactcgcccaccagccccacctactcgcccacctcccccaaaggctcaacctac
tctcccacttcccctggttactcgcccaccagccccacctacagtctcacaagcccggct
atcagcccggatgacagtgacgaggagaactga

DBGET integrated database retrieval system