KEGG   Homo sapiens (human): 5431Help
Entry
5431              CDS       T01001                                 

Gene name
POLR2B, POL2RB, RPB2, hRPB140
Definition
(RefSeq) polymerase (RNA) II subunit B (EC:2.7.7.6)
  KO
K03010  
DNA-directed RNA polymerase II subunit RPB2 [EC:2.7.7.6]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Huntington's disease
Epstein-Barr virus infection
Module
RNA polymerase II, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    5431 (POLR2B)
   00240 Pyrimidine metabolism
    5431 (POLR2B)
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    5431 (POLR2B)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    5431 (POLR2B)
  Infectious diseases
   05169 Epstein-Barr virus infection
    5431 (POLR2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     5431 (POLR2B)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     5431 (POLR2B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5431 (POLR2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q12
AA seq 1174 aa AA seqDB search
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY
SAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD
PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM
VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK
KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ
KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP
ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE
VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG
VVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV
AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGM
RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELESTNRRYTKRDCSTFLRTSE
TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY
HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR
DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC
RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacgcggatgaggatatgcaatatgatgaggatgatgatgaaatcaccccggat
ttgtggcaagaagcatgctggattgtaatcagttcctattttgacgagaaaggcttggtt
agacaacagctggattcttttgatgagtttattcagatgtctgttcaaagaattgtggaa
gacgctcctcctatagacctacaggctgaagctcagcatgctagtggagaagttgaagaa
ccgccacgatatttgctgaagtttgaacaaatttatctttccaagcctacccattgggaa
agagatggtgctccttcaccaatgatgcccaatgaagctagattaaggaatctcacgtat
tctgctccgctttatgttgatataacaaaaacagtcattaaagaaggtgaagaacaactt
cagactcagcatcagaaaacttttataggaaaaattccaattatgttgcggtcaacttac
tgccttttgaatggcttgacagatcgtgatctttgtgagttaaatgaatgccctttggat
cctggtggctatttcattattaatggatcagaaaaggttctgattgcccaagagaaaatg
gcaacaaacacagtttatgtgtttgccaaaaaggattctaaatatgcctacacaggagag
tgtagatcatgtcttgagaattcttcccgacccaccagtactatatgggttagcatgctg
gcaagaggaggacagggtgccaagaagagtgctattggtcagcgcattgtggcaactcta
ccatatatcaagcaagaagttcccatcattattgtgttcagagcattaggttttgtgtcc
gacagagatattttagaacatattatttatgattttgaagatccagagatgatggaaatg
gttaaaccttctctcgatgaagcttttgtcatccaagaacagaatgttgcactaaatttc
attggttcaagaggagcaaagcctggtgttactaaagagaaaagaattaaatatgcaaag
gaagttttacaaaaagaaatgctccctcatgttggtgtcagtgatttttgtgagaccaaa
aaagcctatttcttgggatacatggttcataggttacttctggcagctttgggtagaaga
gaactagatgacagagatcactatggaaacaagagattggatcttgctgggccgctgctt
gcattcttatttagaggtatgtttaagaatttgcttaaagaagtgcggatctatgcacag
aaatttattgatcgaggaaaggattttaacttggagttggcaattaaaacacggatcata
tctgatggcctaaaatactctttagctactggaaactggggtgatcaaaagaaagctcat
caagccagagctggagtatctcaggtgttaaaccgcctgacttttgcgtctactctttct
cacctgcgtcgtttaaattctcctattggtagagacggcaagctagcaaaaccaagacag
ttgcataatacgttgtggggaatggtgtgtcctgccgagaccccagagggccatgctgta
ggacttgtgaagaatttagccttgatggcgtatatttcagttggatctcaaccatctcca
attctggaatttttagaagaatggagtatggaaaatttagaagaaatttctcctgcagct
attgctgatgcaaccaagatttttgttaatggctgctgggttggaatacataaagatccc
gaacaacttatgaacaccctaaggaaattgagacgtcagatggacatcattgtgtctgaa
gtttctatgatcagagatattcgagagagggagattcggatctatacggatgcaggccgt
atttgtagaccacttctgattgtggaaaaacaaaagctacttttgaagaagaggcatatt
gaccaattgaaagagagagaatataacaactatagttggcaggatcttgtggccagtggg
gtagtggagtatattgataccctggaagaagaaacagtgatgcttgcaatgactccagat
gatttacaggagaaagaagtagcttattgttccacatatacacactgtgagattcatccc
tcaatgatccttggtgtctgtgcatctattattccctttcctgatcataaccagtcccct
agaaacacataccagtctgctatgggtaagcaggctatgggagtttacatcaccaacttc
catgttcgcatggacacattggcccatgttctctattatcctcaaaagccacttgtgact
acacggtctatggaatatctacgatttagagagctgccagcaggcatcaactcaattgtg
gccattgcatcatacactggatataatcaggaagactctgttatcatgaatcgttcagct
gtagaccgcggcttcttcaggtctgttttctatcgctcatacaaagaacaggagtctaaa
aaaggatttgatcaagaagaagtttttgagaagcctacacgtgaaacatgccagggcatg
aggcatgccatttacgacaagctggatgatgatggtttgatagctccaggggttcgtgta
tcaggagatgatgttattataggcaaaacagtcaccttgcctgaaaatgaagatgaattg
gagagcaccaatagacgctataccaagagagactgtagcacttttctcagaactagcgag
acgggcattgtggatcaggttatggtaactctcaatcaggaaggatataaattttgtaaa
ataagggtacgctctgttaggattccacagattggagacaaatttgctagtcgacatggt
caaaagggtacttgtggtattcagtatagacaagaggatatgcctttcacctgtgaaggt
atcacccctgatatcatcatcaatccccatgccatcccctctcgtatgactattggtcac
ttaattgaatgccttcaagggaaggtatcggctaacaagggtgaaattggtgatgccact
ccatttaatgatgctgttaacgtgcagaagatttctaatcttttatctgattatggctat
catctcagaggaaatgaggtcctgtacaatgggttcactggtcgaaaaatcacatcacaa
atatttattggccccacttattaccagcgtttgaagcatatggtggatgataagattcac
tctcgtgctaggggacctattcagatcctcaatagacagcccatggagggtagatctcgt
gatggtggcctgcgttttggagaaatggaacgagattgtcagattgcccatggagcagcc
cagtttttaagggaaagattgtttgaggcatcagatccatatcaggttcatgtttgcaat
ctttgtggaataatggcgattgccaacaccaggacccatacatatgaatgcaggggctgc
cgcaataaaacccagatttctttggtgcgaatgccttacgcatgcaaactattgtttcag
gaacttatgtctatgagtattgcaccgcgaatgatgagtgtttag

DBGET integrated database retrieval system