KEGG   Homo sapiens (human): 54407Help
Entry
54407             CDS       T01001                                 

Gene name
SLC38A2, ATA2, PRO1068, SAT2, SNAT2
Definition
(RefSeq) solute carrier family 38 member 2
  KO
K14207  
solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 2
Organism
hsa  Homo sapiens (human)
Pathway
Glutamatergic synapse
GABAergic synapse
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    54407 (SLC38A2)
  Nervous system
   04724 Glutamatergic synapse
    54407 (SLC38A2)
   04727 GABAergic synapse
    54407 (SLC38A2)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   54407 (SLC38A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q
AA seq 506 aa AA seqDB search
MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKK
KYETEFHPGTTSFGMSVFNLSNAIVGSGILGLSYAMANTGIALFIILLTFVSIFSLYSVH
LLLKTANEGGSLLYEQLGYKAFGLVGKLAASGSITMQNIGAMSSYLFIVKYELPLVIQAL
TNIEDKTGLWYLNGNYLVLLVSLVVILPLSLFRNLGYLGYTSGLSLLCMVFFLIVVICKK
FQVPCPVEAALIINETINTTLTQPTALVPALSHNVTENDSCRPHYFIFNSQTVYAVPILI
FSFVCHPAVLPIYEELKDRSRRRMMNVSKISFFAMFLMYLLAALFGYLTFYEHVESELLH
TYSSILGTDILLLIVRLAVLMAVTLTVPVVIFPIRSSVTHLLCASKDFSWWRHSLITVSI
LAFTNLLVIFVPTIRDIFGFIGASAASMLIFILPSAFYIKLVKKEPMKSVQKIGALFFLL
SGVLVMTGSMALIVLDWVHNAPGGGH
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggccgaaatgggacgattcagtatttccccggatgaagacagcagcagctac
agttccaacagcgacttcaactactcctaccccaccaagcaagctgctctgaaaagccat
tatgcagatgtagatcctgaaaaccagaactttttacttgaatcgaatttggggaagaag
aagtatgaaacagaatttcatccaggtactacttcctttggaatgtcagtatttaatctg
agcaatgcgattgtgggcagtggaatccttgggctttcttatgccatggctaatactgga
attgctctttttataattctcttgacatttgtgtcaatattttccctgtattctgttcat
ctccttttgaagactgccaatgaaggagggtctttattatatgaacaattgggatataag
gcatttggattagttggaaagcttgcagcatctggatcaattacaatgcagaacattgga
gctatgtcaagctacctcttcatagtgaaatatgagttgcctttggtgatccaggcatta
acgaacattgaagataaaactggattgtggtatctgaacgggaactatttggttctgttg
gtgtcattggtggtcattcttcctttgtcgctgtttagaaatttaggatatttgggatat
accagtggcctttccttgttgtgtatggtgttctttctgattgtggtcatttgcaagaaa
tttcaggttccgtgtcctgtggaagctgctttgataattaacgaaacaataaacaccacc
ttaacacagccaacagctcttgtacctgctttgtcacataacgtgactgaaaatgactct
tgcagacctcactattttattttcaactcacagactgtctatgctgtgccaattctgatc
ttttcatttgtctgtcatcctgctgttcttcccatctatgaagaactgaaagaccgcagc
cgtagaagaatgatgaatgtgtccaagatttcattttttgctatgtttctcatgtatctg
cttgccgccctctttggatacctaacattttacgaacatgttgagtcagaattgcttcat
acctactcttctatcttgggaactgatattcttcttctcattgtccgtctggctgtgtta
atggctgtgaccctgacagtaccagtagttattttcccaatccggagttctgtaactcac
ttgttgtgtgcatcaaaagatttcagttggtggcgtcatagtctcattacagtgtctatc
ttggcatttaccaatttacttgtcatctttgtcccaactattagggatatctttggtttt
attggtgcatctgcagcttctatgttgatttttattcttccttctgccttctatatcaag
ttggtgaagaaagaacctatgaaatctgtacaaaagattggggctttgttcttcctgtta
agtggtgtactggtgatgaccggaagcatggccttgattgttttggattgggtacacaat
gcacctggaggtggccattaa

DBGET integrated database retrieval system