KEGG   Homo sapiens (human): 5443Help
Entry
5443              CDS       T01001                                 

Gene name
POMC, ACTH, CLIP, LPH, MSH, NPP, POC
Definition
(RefSeq) proopiomelanocortin
  KO
K05228  
proopiomelanocortin
Organism
hsa  Homo sapiens (human)
Pathway
Melanogenesis
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    5443 (POMC)
   04916 Melanogenesis
    5443 (POMC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p23.3
AA seq 267 aa AA seqDB search
MPRSCCSRSGALLLALLLQASMEVRGWCLESSQCQDLTTESNLLECIRACKPDLSAETPM
FPGNGDEQPLTENPRKYVMGHFRWDRFGRRNSSSSGSSGAGQKREDVSAGEDCGPLPEGG
PEPRSDGAKPGPREGKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEFKREL
TGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGF
MTSEKSQTPLVTLFKNAIIKNAYKKGE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgccgagatcgtgctgcagccgctcgggggccctgttgctggccttgctgcttcaggcc
tccatggaagtgcgtggctggtgcctggagagcagccagtgtcaggacctcaccacggaa
agcaacctgctggagtgcatccgggcctgcaagcccgacctctcggccgagactcccatg
ttcccgggaaatggcgacgagcagcctctgaccgagaacccccggaagtacgtcatgggc
cacttccgctgggaccgattcggccgccgcaacagcagcagcagcggcagcagcggcgca
gggcagaagcgcgaggacgtctcagcgggcgaagactgcggcccgctgcctgagggcggc
cccgagccccgcagcgatggtgccaagccgggcccgcgcgagggcaagcgctcctactcc
atggagcacttccgctggggcaagccggtgggcaagaagcggcgcccagtgaaggtgtac
cctaacggcgccgaggacgagtcggccgaggccttccccctggagttcaagagggagctg
actggccagcgactccgggagggagatggccccgacggccctgccgatgacggcgcaggg
gcccaggccgacctggagcacagcctgctggtggcggccgagaagaaggacgagggcccc
tacaggatggagcacttccgctggggcagcccgcccaaggacaagcgctacggcggtttc
atgacctccgagaagagccagacgcccctggtgacgctgttcaaaaacgccatcatcaag
aacgcctacaagaagggcgagtga

DBGET integrated database retrieval system