KEGG   Homo sapiens (human): 54472Help
Entry
54472             CDS       T01001                                 

Gene name
TOLLIP, IL-1RAcPIP
Definition
toll interacting protein
Orthology
K05402  
toll-interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    54472 (TOLLIP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   54472 (TOLLIP)
  Exosomal proteins of bladder cancer cells
   54472 (TOLLIP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.5
AA seq 274 aa AA seqDB search
MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVGTVGRLNITVV
QAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIF
DERAFSMDDRIAWTHITIPESLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMV
MPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKAIQDM
FPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaccgtcagcactcagcgcgggccggtgtacatcggtgagctcccgcaggac
ttcctccgcatcacgcccacacagcagcagcggcaggtccagctggacgcccaggcggcc
cagcagctgcagtacggaggcgcagtgggcaccgtgggccgactgaacatcacggtggta
caggcaaagttggccaagaattacggcatgacccgcatggacccctactgccgactgcgc
ctgggctacgcggtgtacgagacgcccacggcacacaatggcgccaagaatccccgctgg
aataaggtcatccactgcacggtgcccccaggcgtggactctttctatctcgagatcttc
gatgagagagccttctccatggacgaccgcattgcctggacccacatcaccatcccggag
tccctgaggcagggcaaggtggaggacaagtggtacagcctgagcgggaggcagggggac
gacaaggagggcatgatcaacctcgtcatgtcctacgcgctgcttccagctgccatggtg
atgccaccccagcccgtggtcctgatgccaacagtgtaccagcagggcgttggctatgtg
cccatcacagggatgcccgctgtctgtagccccggcatggtgcccgtggccctgcccccg
gccgccgtgaacgcccagccccgctgtagcgaggaggacctgaaagccatccaggacatg
ttccccaacatggaccaggaggtgatccgctccgtgctggaagcccagcgagggaacaag
gatgccgccatcaactccctgctgcagatgggggaggagccatag

DBGET integrated database retrieval system