KEGG   Homo sapiens (human): 545Help
Entry
545               CDS       T01001                                 

Gene name
ATR, FCTCS, FRP1, MEC1, SCKL, SCKL1
Definition
ataxia telangiectasia and Rad3 related (EC:2.7.11.1)
Orthology
K06640  
serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Fanconi anemia pathway
Cell cycle
p53 signaling pathway
HTLV-I infection
Disease
H00037  
Alveolar rhabdomyosarcoma
H00992  
Seckel syndrome
Class
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:hsa03460]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:hsa04115]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q23
AA seq 2644 aa AA seqDB search
MGEHGLELASMIPALRELGSATPEEYNTVVQKPRQILCQFIDRILTDVNVVAVELVKKTD
SQPTSVMLLDFIQHIMKSSPLMFVNVSGSHEAKGSCIEFSNWIITRLLRIAATPSCHLLH
KKICEVICSLLFLFKSKSPAIFGVLTKELLQLFEDLVYLHRRNVMGHAVEWPVVMSRFLS
QLDEHMGYLQSAPLQLMSMQNLEFIEVTLLMVLTRIIAIVFFRRQELLLWQIGCVLLEYG
SPKIKSLAISFLTELFQLGGLPAQPASTFFSSFLELLKHLVEMDTDQLKLYEEPLSKLIK
TLFPFEAEAYRNIEPVYLNMLLEKLCVMFEDGVLMRLKSDLLKAALCHLLQYFLKFVPAG
YESALQVRKVYVRNICKALLDVLGIEVDAEYLLGPLYAALKMESMEIIEEIQCQTQQENL
SSNSDGISPKRRRLSSSLNPSKRAPKQTEEIKHVDMNQKSILWSALKQKAESLQISLEYS
GLKNPVIEMLEGIAVVLQLTALCTVHCSHQNMNCRTFKDCQHKSKKKPSVVITWMSLDFY
TKVLKSCRSLLESVQKLDLEATIDKVVKIYDALIYMQVNSSFEDHILEDLCGMLSLPWIY
SHSDDGCLKLTTFAANLLTLSCRISDSYSPQAQSRCVFLLTLFPRRIFLEWRTAVYNWAL
QSSHEVIRASCVSGFFILLQQQNSCNRVPKILIDKVKDDSDIVKKEFASILGQLVCTLHG
MFYLTSSLTEPFSEHGHVDLFCRNLKATSQHECSSSQLKASVCKPFLFLLKKKIPSPVKL
AFIDNLHHLCKHLDFREDETDVKAVLGTLLNLMEDPDKDVRVAFSGNIKHILESLDSEDG
FIKELFVLRMKEAYTHAQISRNNELKDTLILTTGDIGRAAKGDLVPFALLHLLHCLLSKS
ASVSGAAYTEIRALVAAKSVKLQSFFSQYKKPICQFLVESLHSSQMTALPNTPCQNADVR
KQDVAHQREMALNTLSEIANVFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTLGKQ
LNVNRREILINNFKYIFSHLVCSCSKDELERALHYLKNETEIELGSLLRQDFQGLHNELL
LRIGEHYQQVFNGLSILASFASSDDPYQGPRDIISPELMADYLQPKLLGILAFFNMQLLS
SSVGIEDKKMALNSLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWDCFV
RCLDHACLGSLLSHVIVALLPLIHIQPKETAAIFHYLIIENRDAVQDFLHEIYFLPDHPE
LKKIKAVLQEYRKETSESTDLQTTLQLSMKAIQHENVDVRIHALTSLKETLYKNQEKLIK
YATDSETVEPIISQLVTVLLKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTETQGKD
FTFVTGVEDSSFAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGH
QLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVKKPIYLSKLGSNFAEWSASWAGYLIT
KVRHDLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGCNQEDQQEVYAEIMAVLKHDD
QHTINTQDIASDLCQLSTQTVFSMLDHLTQWARHKFQALKAEKCPHSKSNRNKVDSMVST
VDYEDYQSVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFITEKKQNIQEHLGFLQKLY
AAMHEPDGVAGVSAIRKAEPSLKEQILEHESLGLLRDATACYDRAIQLEPDQIIHYHGVV
KSMLGLGQLSTVITQVNGVHANRSEWTDELNTYRVEAAWKLSQWDLVENYLAADGKSTTW
SVRLGQLLLSAKKRDITAFYDSLKLVRAEQIVPLSAASFERGSYQRGYEYIVRLHMLCEL
EHSIKPLFQHSPGDSSQEDSLNWVARLEMTQNSYRAKEPILALRRALLSLNKRPDYNEMV
GECWLQSARVARKAGHHQTAYNALLNAGESRLAELYVERAKWLWSKGDVHQALIVLQKGV
ELCFPENETPPEGKNMLIHGRAMLLVGRFMEETANFESNAIMKKYKDVTACLPEWEDGHF
YLAKYYDKLMPMVTDNKMEKQGDLIRYIVLHFGRSLQYGNQFIYQSMPRMLTLWLDYGTK
AYEWEKAGRSDRVQMRNDLGKINKVITEHTNYLAPYQFLTAFSQLISRICHSHDEVFVVL
MEIIAKVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILNKAIHMKKSLEKFVGDATRLTD
KLLELCNKPVDGSSSTLSMSTHFKMLKKLVEEATFSEILIPLQSVMIPTLPSILGTHANH
ASHEPFPGHWAYIAGFDDMVEILASLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLME
FNSLINKCLRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLYKEKGVY
MTGKELRQCMLPKSAALSEKLKVFREFLLPRHPPIFHEWFLRTFPDPTSWYSSRSAYCRS
TAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMV
NGMGPMGTEGLFRRACEVTMRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNET
GEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGW
TPYM
NT seq 7935 nt NT seq  +upstreamnt  +downstreamnt
atgggggaacatggcctggagctggcttccatgatccccgccctgcgggagctgggcagt
gccacaccagaggaatataatacagttgtacagaagccaagacaaattctgtgtcaattc
attgaccggatacttacagatgtaaatgttgttgctgtagaacttgtaaagaaaactgac
tctcagccaacctccgtgatgttgcttgatttcatccagcatatcatgaaatcctcccca
cttatgtttgtaaatgtgagtggaagccatgaggccaaaggcagttgtattgaattcagt
aattggatcataacgagacttctgcggattgcagcaactccctcctgtcatttgttacac
aagaaaatctgtgaagtcatctgttcattattatttctttttaaaagcaagagtcctgct
atttttggggtactcacaaaagaattattacaactttttgaagacttggtttacctccat
agaagaaatgtgatgggtcatgctgtggaatggccagtggtcatgagccgatttttaagt
caattagatgaacacatgggatatttacaatcagctcctttgcagttgatgagtatgcaa
aatttagaatttattgaagtcactttattaatggttcttactcgtattattgcaattgtg
ttttttagaaggcaagaactcttactttggcagataggttgtgttctgctagagtatggt
agtccaaaaattaaatccctagcaattagctttttaacagaactttttcagcttggagga
ctaccagcacaaccagctagcacttttttcagctcatttttggaattattaaaacacctt
gtagaaatggatactgaccaattgaaactctatgaagagccattatcaaagctgataaag
acactatttccctttgaagcagaagcttatagaaatattgaacctgtctatttaaatatg
ctgctggaaaaactctgtgtcatgtttgaagacggtgtgctcatgcggcttaagtctgat
ttgctaaaagcagctttgtgccatttactgcagtatttccttaaatttgtgccagctggg
tatgaatctgctttacaagtcaggaaggtctatgtgagaaatatttgtaaagctcttttg
gatgtgcttggaattgaggtagatgcagagtacttgttgggcccactttatgcagctttg
aaaatggaaagtatggaaatcattgaggagattcaatgccaaactcaacaggaaaacctc
agcagtaatagtgatggaatatcacccaaaaggcgtcgtctcagctcgtctctaaaccct
tctaaaagagcaccaaaacagactgaggaaattaaacatgtggacatgaaccaaaagagc
atattatggagtgcactgaaacagaaagctgaatcccttcagatttcccttgaatacagt
ggcctaaagaatcctgttattgagatgttagaaggaattgctgttgtcttacaactgact
gctctgtgtactgttcattgttctcatcaaaacatgaactgccgtactttcaaggactgt
caacataaatccaagaagaaaccttctgtagtgataacttggatgtcattggatttttac
acaaaagtgcttaagagctgtagaagtttgttagaatctgttcagaaactggacctggag
gcaaccattgataaggtggtgaaaatttatgatgctttgatttatatgcaagtaaacagt
tcatttgaagatcatatcctggaagatttatgtggtatgctctcacttccatggatttat
tcccattctgatgatggctgtttaaagttgaccacatttgccgctaatcttctaacatta
agctgtaggatttcagatagctattcaccacaggcacaatcacgatgtgtgtttcttctg
actctgtttccaagaagaatattccttgagtggagaacagcagtttacaactgggccctg
cagagctcccatgaagtaatccgggctagttgtgttagtggattttttatcttattgcag
cagcagaattcttgtaacagagttcccaagattcttatagataaagtcaaagatgattct
gacattgtcaagaaagaatttgcttctatacttggtcaacttgtctgtactcttcacggc
atgttttatctgacaagttctttaacagaacctttctctgaacacggacatgtggacctc
ttctgtaggaacttgaaagccacttctcaacatgaatgttcatcttctcaactaaaagct
tctgtctgcaagccattccttttcctactgaaaaaaaaaatacctagtccagtaaaactt
gctttcatagataatctacatcatctttgtaagcatcttgattttagagaagatgaaaca
gatgtaaaagcagttcttggaactttattaaatttaatggaagatccagacaaagatgtt
agagtggcttttagtggaaatatcaagcacatattggaatccttggactctgaagatgga
tttataaaggagctttttgtcttaagaatgaaggaagcatatacacatgcccaaatatca
agaaataatgagctgaaggataccttgattcttacaacaggggatattggaagggccgca
aaaggagatttggtaccatttgcactcttacacttattgcattgtttgttatccaagtca
gcatctgtctctggagcagcatacacagaaattagagctctggttgcagctaaaagtgtt
aaactgcaaagttttttcagccagtataagaaacccatctgtcagtttttggtagaatcc
cttcactctagtcagatgacagcacttccgaatactccatgccagaatgctgacgtgcga
aaacaagatgtggctcaccagagagaaatggctttaaatacgttgtctgaaattgccaac
gttttcgactttcctgatcttaatcgttttcttactaggacattacaagttctactacct
gatcttgctgccaaagcaagccctgcagcttctgctctcattcgaactttaggaaaacaa
ttaaatgtcaatcgtagagagattttaataaacaacttcaaatatattttttctcatttg
gtctgttcttgttccaaagatgaattagaacgtgcccttcattatctgaagaatgaaaca
gaaattgaactggggagcctgttgagacaagatttccaaggattgcataatgaattattg
ctgcgtattggagaacactatcaacaggtttttaatggtttgtcaatacttgcctcattt
gcatccagtgatgatccatatcagggcccgagagatatcatatcacctgaactgatggct
gattatttacaacccaaattgttgggcattttggctttttttaacatgcagttactgagc
tctagtgttggcattgaagataagaaaatggccttgaacagtttgatgtctttgatgaag
ttaatgggacccaaacatgtcagttctgtgagggtgaagatgatgaccacactgagaact
ggccttcgattcaaggatgattttcctgaattgtgttgcagagcttgggactgctttgtt
cgctgcctggatcatgcttgtctgggctcccttctcagtcatgtaatagtagctttgtta
cctcttatacacatccagcctaaagaaactgcagctatcttccactacctcataattgaa
aacagggatgctgtgcaagattttcttcatgaaatatattttttacctgatcatccagaa
ttaaaaaagataaaagccgttctccaggaatacagaaaggagacctctgagagcactgat
cttcagacaactcttcagctctctatgaaggccattcaacatgaaaatgtcgatgttcgt
attcatgctcttacaagcttgaaggaaaccttgtataaaaatcaggaaaaactgataaag
tatgcaacagacagtgaaacagtagaacctattatctcacagttggtgacagtgcttttg
aaaggttgccaagatgcaaactctcaagctcggttgctctgtggggaatgtttaggggaa
ttgggggcgatagatccaggtcgattagatttctcaacaactgaaactcaaggaaaagat
tttacatttgtgactggagtagaagattcaagctttgcctatggattattgatggagcta
acaagagcttaccttgcgtatgctgataatagccgagctcaagattcagctgcctatgcc
attcaggagttgctttctatttatgactgtagagagatggagaccaacggcccaggtcac
caattgtggaggagatttcctgagcatgttcgggaaatactagaacctcatctaaatacc
agatacaagagttctcagaagtcaaccgattggtctggagtaaagaagccaatttactta
agtaaattgggtagtaactttgcagaatggtcagcatcttgggcaggttatcttattaca
aaggttcgacatgatcttgccagtaaaattttcacctgctgtagcattatgatgaagcat
gatttcaaagtgaccatctatcttcttccacatattctggtgtatgtcttactgggttgt
aatcaagaagatcagcaggaggtttatgcagaaattatggcagttctaaagcatgacgat
cagcataccataaatacccaagacattgcatctgatctgtgtcaactcagtacacagact
gtgttctccatgcttgaccatctcacacagtgggcaaggcacaaatttcaggcactgaaa
gctgagaaatgtccacacagcaaatcaaacagaaataaggtagactcaatggtatctact
gtggattatgaagactatcagagtgtaacccgttttctagacctcataccccaggatact
ctggcagtagcttcctttcgctccaaagcatacacacgagctgtaatgcactttgaatca
tttattacagaaaagaagcaaaatattcaggaacatcttggatttttacagaaattgtat
gctgctatgcatgaacctgatggagtggccggagtcagtgcaattagaaaggcagaacca
tctctaaaagaacagatccttgaacatgaaagccttggcttgctgagggatgccactgct
tgttatgacagggctattcagctagaaccagaccagatcattcattatcatggtgtagta
aagtccatgttaggtcttggtcagctgtctactgttatcactcaggtgaatggagtgcat
gctaacaggtccgagtggacagatgaattaaacacgtacagagtggaagcagcttggaaa
ttgtcacagtgggatttggtggaaaactatttggcagcagatggaaaatctacaacatgg
agtgtcagactgggacagctattattatcagccaaaaaaagagatatcacagctttttat
gactcactgaaactagtgagagcagaacaaattgtacctctttcagctgcaagctttgaa
agaggctcctaccaacgaggatatgaatatattgtgagattgcacatgttatgtgagttg
gagcatagcatcaaaccacttttccagcattctccaggtgacagttctcaagaagattct
ctaaactgggtagctcgactagaaatgacccagaattcctacagagccaaggagcctatc
ctggctctccggagggctttactaagcctcaacaaaagaccagattacaatgaaatggtt
ggagaatgctggctgcagagtgccagggtagctagaaaggctggtcaccaccagacagcc
tacaatgctctccttaatgcaggggaatcacgactcgctgaactgtacgtggaaagggca
aagtggctctggtccaagggtgatgttcaccaggcactaattgttcttcaaaaaggtgtt
gaattatgttttcctgaaaatgaaaccccacctgagggtaagaacatgttaatccatggt
cgagctatgctactagtgggccgatttatggaagaaacagctaactttgaaagcaatgca
attatgaaaaaatataaggatgtgaccgcgtgcctgccagaatgggaggatgggcatttt
taccttgccaagtactatgacaaattgatgcccatggtcacagacaacaaaatggaaaag
caaggtgatctcatccggtatatagttcttcattttggcagatctctacaatatggaaat
cagttcatatatcagtcaatgccacgaatgttaactctatggcttgattatggtacaaag
gcatatgaatgggaaaaagctggccgctccgatcgtgtacaaatgaggaatgatttgggt
aaaataaacaaggttatcacagagcatacaaactatttagctccatatcaatttttgact
gctttttcacaattgatctctcgaatttgtcattctcacgatgaagtttttgttgtcttg
atggaaataatagccaaagtatttctagcctatcctcaacaagcaatgtggatgatgaca
gctgtgtcaaagtcatcttatcccatgcgtgtgaacagatgcaaggaaatcctcaataaa
gctattcatatgaaaaaatccttagagaagtttgttggagatgcaactcgcctaacagat
aagcttctagaattgtgcaataaaccggttgatggaagtagttccacattaagcatgagc
actcattttaaaatgcttaaaaagctggtagaagaagcaacatttagtgaaatcctcatt
cctctacaatcagtcatgatacctacacttccatcaattctgggtacccatgctaaccat
gctagccatgaaccatttcctggacattgggcctatattgcagggtttgatgatatggtg
gaaattcttgcttctcttcagaaaccaaagaagatttctttaaaaggctcagatggaaag
ttctacatcatgatgtgtaagccaaaagatgacctgagaaaggattgtagactaatggaa
ttcaattccttgattaataagtgcttaagaaaagatgcagagtctcgtagaagagaactt
catattcgaacatatgcagttattccactaaatgatgaatgtgggattattgaatgggtg
aacaacactgctggtttgagacctattctgaccaaactatataaagaaaagggagtgtat
atgacaggaaaagaacttcgccagtgtatgctaccaaagtcagcagctttatctgaaaaa
ctcaaagtattccgagaatttctcctgcccaggcatcctcctatttttcatgagtggttt
ctgagaacattccctgatcctacatcatggtacagtagtagatcagcttactgccgttcc
actgcagtaatgtcaatggttggttatattctggggcttggagaccgtcatggtgaaaat
attctctttgattctttgactggtgaatgcgtacatgtagatttcaattgtcttttcaat
aagggagaaacctttgaagttccagaaattgtgccatttcgcctgactcataatatggtt
aatggaatgggtcctatgggaacagagggtctttttcgaagagcatgtgaagttacaatg
aggctgatgcgtgatcagcgagagcctttaatgagtgtcttaaagacttttctacatgat
cctcttgtggaatggagtaaaccagtgaaagggcattccaaagcgccactgaatgaaact
ggagaagttgtcaatgaaaaggccaagacccatgttcttgacattgagcagcgactacaa
ggtgtaatcaagactcgaaatagagtgacaggactgccgttatctattgaaggacatgtg
cattaccttatacaggaagctactgatgaaaacttactatgccagatgtatcttggttgg
actccatatatgtga

DBGET integrated database retrieval system