KEGG   Homo sapiens (human): 5465Help
Entry
5465              CDS       T01001                                 

Gene name
PPARA, NR1C1, PPAR, PPARalpha, hPPAR
Definition
peroxisome proliferator-activated receptor alpha
Orthology
K07294  
peroxisome proliferator-activated receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hepatitis C
Drug target
Clofibrate: 
Bezafibrate: 
Aluminium clofibrate: 
Gemfibrozil: 
Fenofibrate: 
Ciprofibrate: 
Etofibrate: 
Choline fenofibrate: 
Other: 
Class
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.31
AA seq 468 aa AA seqDB search
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSC
PGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFV
IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI
FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggtggacacggaaagcccactctgccccctctccccactcgaggccggcgatctagag
agcccgttatctgaagagttcctgcaagaaatgggaaacatccaagagatttcgcaatcc
atcggcgaggatagttctggaagctttggctttacggaataccagtatttaggaagctgt
cctggctcagatggctcggtcatcacggacacgctttcaccagcttcgagcccctcctcg
gtgacttatcctgtggtccccggcagcgtggacgagtctcccagtggagcattgaacatc
gaatgtagaatctgcggggacaaggcctcaggctatcattacggagtccacgcgtgtgaa
ggctgcaagggcttctttcggcgaacgattcgactcaagctggtgtatgacaagtgcgac
cgcagctgcaagatccagaaaaagaacagaaacaaatgccagtattgtcgatttcacaag
tgcctttctgtcgggatgtcacacaacgcgattcgttttggacgaatgccaagatctgag
aaagcaaaactgaaagcagaaattcttacctgtgaacatgacatagaagattctgaaact
gcagatctcaaatctctggccaagagaatctacgaggcctacttgaagaacttcaacatg
aacaaggtcaaagcccgggtcatcctctcaggaaaggccagtaacaatccaccttttgtc
atacatgatatggagacactgtgtatggctgagaagacgctggtggccaagctggtggcc
aatggcatccagaacaaggaggcggaggtccgcatctttcactgctgccagtgcacgtca
gtggagaccgtcacggagctcacggaattcgccaaggccatcccaggcttcgcaaacttg
gacctgaacgatcaagtgacattgctaaaatacggagtttatgaggccatattcgccatg
ctgtcttctgtgatgaacaaagacgggatgctggtagcgtatggaaatgggtttataact
cgtgaattcctaaaaagcctaaggaaaccgttctgtgatatcatggaacccaagtttgat
tttgccatgaagttcaatgcactggaactggatgacagtgatatctccctttttgtggct
gctatcatttgctgtggagatcgtcctggccttctaaacgtaggacacattgaaaaaatg
caggagggtattgtacatgtgctcagactccacctgcagagcaaccacccggacgatatc
tttctcttcccaaaacttcttcaaaaaatggcagacctccggcagctggtgacggagcat
gcgcagctggtgcagatcatcaagaagacggagtcggatgctgcgctgcacccgctactg
caggagatctacagggacatgtactga

DBGET integrated database retrieval system