KEGG   Homo sapiens (human): 5465Help
Entry
5465              CDS       T01001                                 

Gene name
PPARA, NR1C1, PPAR, PPARalpha, hPPAR
Definition
peroxisome proliferator-activated receptor alpha
Orthology
K07294  
peroxisome proliferator-activated receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
cAMP signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hepatitis C
Drug target
Clofibrate: 
Bezafibrate: 
Aluminium clofibrate: 
Gemfibrozil: 
Fenofibrate: 
Ciprofibrate: 
Etofibrate: 
Choline fenofibrate: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    5465 (PPARA)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    5465 (PPARA)
   03320 PPAR signaling pathway
    5465 (PPARA)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5465 (PPARA)
  Infectious diseases
   05160 Hepatitis C
    5465 (PPARA)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    5465 (PPARA)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   5465 (PPARA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.31
AA seq 468 aa AA seqDB search
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSC
PGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFV
IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI
FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggtggacacggaaagcccactctgccccctctccccactcgaggccggcgatctagag
agcccgttatctgaagagttcctgcaagaaatgggaaacatccaagagatttcgcaatcc
atcggcgaggatagttctggaagctttggctttacggaataccagtatttaggaagctgt
cctggctcagatggctcggtcatcacggacacgctttcaccagcttcgagcccctcctcg
gtgacttatcctgtggtccccggcagcgtggacgagtctcccagtggagcattgaacatc
gaatgtagaatctgcggggacaaggcctcaggctatcattacggagtccacgcgtgtgaa
ggctgcaagggcttctttcggcgaacgattcgactcaagctggtgtatgacaagtgcgac
cgcagctgcaagatccagaaaaagaacagaaacaaatgccagtattgtcgatttcacaag
tgcctttctgtcgggatgtcacacaacgcgattcgttttggacgaatgccaagatctgag
aaagcaaaactgaaagcagaaattcttacctgtgaacatgacatagaagattctgaaact
gcagatctcaaatctctggccaagagaatctacgaggcctacttgaagaacttcaacatg
aacaaggtcaaagcccgggtcatcctctcaggaaaggccagtaacaatccaccttttgtc
atacatgatatggagacactgtgtatggctgagaagacgctggtggccaagctggtggcc
aatggcatccagaacaaggaggcggaggtccgcatctttcactgctgccagtgcacgtca
gtggagaccgtcacggagctcacggaattcgccaaggccatcccaggcttcgcaaacttg
gacctgaacgatcaagtgacattgctaaaatacggagtttatgaggccatattcgccatg
ctgtcttctgtgatgaacaaagacgggatgctggtagcgtatggaaatgggtttataact
cgtgaattcctaaaaagcctaaggaaaccgttctgtgatatcatggaacccaagtttgat
tttgccatgaagttcaatgcactggaactggatgacagtgatatctccctttttgtggct
gctatcatttgctgtggagatcgtcctggccttctaaacgtaggacacattgaaaaaatg
caggagggtattgtacatgtgctcagactccacctgcagagcaaccacccggacgatatc
tttctcttcccaaaacttcttcaaaaaatggcagacctccggcagctggtgacggagcat
gcgcagctggtgcagatcatcaagaagacggagtcggatgctgcgctgcacccgctactg
caggagatctacagggacatgtactga

DBGET integrated database retrieval system