KEGG   Homo sapiens (human): 5468Help
Entry
5468              CDS       T01001                                 

Gene name
PPARG, CIMT1, GLM1, NR1C3, PPARG1, PPARG2, PPARgamma
Definition
(RefSeq) peroxisome proliferator activated receptor gamma
  KO
K08530  
peroxisome proliferator-activated receptor gamma
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Osteoclast differentiation
Huntington's disease
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Disease
H00032  
Thyroid cancer
H00409  
Type II diabetes mellitus
H00420  
Familial partial lipodystrophy (FPL)
Drug target
Troglitazone: 
Rosiglitazone: 
Pioglitazone: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    5468 (PPARG)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    5468 (PPARG)
  Development
   04380 Osteoclast differentiation
    5468 (PPARG)
  Aging
   04211 Longevity regulating pathway - mammal
    5468 (PPARG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5468 (PPARG)
   05202 Transcriptional misregulation in cancers
    5468 (PPARG)
   05216 Thyroid cancer
    5468 (PPARG)
  Neurodegenerative diseases
   05016 Huntington's disease
    5468 (PPARG)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    5468 (PPARG)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   5468 (PPARG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p25
AA seq 505 aa AA seqDB search
MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaactctgggagattctcctattgacccagaaagcgattccttcactgataca
ctgtctgcaaacatatcacaagaaatgaccatggttgacacagagatgccattctggccc
accaactttgggatcagctccgtggatctctccgtaatggaagaccactcccactccttt
gatatcaagcccttcactactgttgacttctccagcatttctactccacattacgaagac
attccattcacaagaacagatccagtggttgcagattacaagtatgacctgaaacttcaa
gagtaccaaagtgcaatcaaagtggagcctgcatctccaccttattattctgagaagact
cagctctacaataagcctcatgaagagccttccaactccctcatggcaattgaatgtcgt
gtctgtggagataaagcttctggatttcactatggagttcatgcttgtgaaggatgcaag
ggtttcttccggagaacaatcagattgaagcttatctatgacagatgtgatcttaactgt
cggatccacaaaaaaagtagaaataaatgtcagtactgtcggtttcagaaatgccttgca
gtggggatgtctcataatgccatcaggtttgggcggatgccacaggccgagaaggagaag
ctgttggcggagatctccagtgatatcgaccagctgaatccagagtccgctgacctccgg
gccctggcaaaacatttgtatgactcatacataaagtccttcccgctgaccaaagcaaag
gcgagggcgatcttgacaggaaagacaacagacaaatcaccattcgttatctatgacatg
aattccttaatgatgggagaagataaaatcaagttcaaacacatcacccccctgcaggag
cagagcaaagaggtggccatccgcatctttcagggctgccagtttcgctccgtggaggct
gtgcaggagatcacagagtatgccaaaagcattcctggttttgtaaatcttgacttgaac
gaccaagtaactctcctcaaatatggagtccacgagatcatttacacaatgctggcctcc
ttgatgaataaagatggggttctcatatccgagggccaaggcttcatgacaagggagttt
ctaaagagcctgcgaaagccttttggtgactttatggagcccaagtttgagtttgctgtg
aagttcaatgcactggaattagatgacagcgacttggcaatatttattgctgtcattatt
ctcagtggagaccgcccaggtttgctgaatgtgaagcccattgaagacattcaagacaac
ctgctacaagccctggagctccagctgaagctgaaccaccctgagtcctcacagctgttt
gccaagctgctccagaaaatgacagacctcagacagattgtcacggaacacgtgcagcta
ctgcaggtgatcaagaagacggagacagacatgagtcttcacccgctcctgcaggagatc
tacaaggacttgtactag

DBGET integrated database retrieval system