KEGG   Homo sapiens (human): 5468Help
Entry
5468              CDS       T01001                                 

Gene name
PPARG, CIMT1, GLM1, NR1C3, PPARG1, PPARG2, PPARgamma
Definition
(RefSeq) peroxisome proliferator activated receptor gamma
  KO
K08530  peroxisome proliferator-activated receptor gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04380  Osteoclast differentiation
hsa04714  Thermogenesis
hsa05016  Huntington's disease
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05216  Thyroid cancer
Network
N00126  PAX8-PPARG fusion to PPARG-mediated transcription
N00138  EWSR1-NR4A3
Disease
H00032  Thyroid cancer
H00409  Type II diabetes mellitus
H00420  Familial partial lipodystrophy (FPL)
Drug target
Aleglitazar: D08845
Arhalofenate: D09579
Ciglitazone: D03493
Darglitazone sodium: D03653
Edaglitazone sodium: D03941
Indeglitazar: D09350
Mifobate: D05030
Muraglitazar: D05091
Netoglitazone: D05150
Pioglitazone (DG00117): D00945 D08378
Reglitazar: D01971
Rivoglitazone: D05739
Rosiglitazone (DG00116): D00596 D08491
Troglitazone: D00395
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    5468 (PPARG)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    5468 (PPARG)
  Development
   04380 Osteoclast differentiation
    5468 (PPARG)
  Aging
   04211 Longevity regulating pathway - mammal
    5468 (PPARG)
  Environmental adaptation
   04714 Thermogenesis
    5468 (PPARG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5468 (PPARG)
   05202 Transcriptional misregulation in cancers
    5468 (PPARG)
   05216 Thyroid cancer
    5468 (PPARG)
  Neurodegenerative diseases
   05016 Huntington's disease
    5468 (PPARG)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    5468 (PPARG)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   5468 (PPARG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PPARgamma_N zf-C4 Hormone_recep Tmemb_55A
Motif
Other DBs
NCBI-GeneID: 5468
NCBI-ProteinID: NP_056953
OMIM: 601487
HGNC: 9236
Ensembl: ENSG00000132170
Vega: OTTHUMG00000129764
Pharos: P37231(Tclin)
UniProt: P37231
Structure
PDB: 
3U9Q 3V9V 3B1M 3V9T 5Y2T 4CI5 5Y2O 1ZGY 5GTN 3WJ5 4F9M 3LMP 2ZVT 5TWO 3WJ4 3ADX 3ET3 2HWQ 5JI0 4Y29 3NOA 2FVJ 5LSG 5HZC 3VSO 4A4V 4A4W 3TY0 2YFE 3R5N 2HFP 3FEJ 2XKW 2VSR 2Q5S 3ADW 2F4B 6F2L 5UGM 5GTO 3WMH 4EM9 3V9Y 3T03 3B0Q 3KMG 3HOD 3H0A 2I4J 2I4P 2GTK 1FM6 1FM9 3B0R 3VN2 6ENQ 5DWL 4YT1 2Q61 2Q59 1PRG 4XUH 4R06 3VJH 5TTO 5F9B 3ADS 2P4Y 2I4Z 2ZK2 3ADV 3BC5 4L98 2ATH 5WQX 5DVC 3X1H 4R6S 4R2U 4OJ4 3SZ1 3R8I 3PBA 3AN3 3AN4 3GBK 3G9E 3FUR 3CS8 2Q8S 2Q5P 2POB 2G0H 1K74 2PRG 3IA6 5WR1 2HWR 5GTP 3PO9 2VV4 2VST 1I7I 2ZK0 4L96 4XUM 3X1I 3VSP 3ET0 3D6D 2ZNO 3CWD 2Q6S 1RDT 3R8A 2ZK6 2Q6R 4XLD 2ZK5 4XTA 4JL4 4HEE 4E4K 4E4Q 3QT0 1ZEO 1KNU 4EMA 2G0G 5U5L 3S9S 3OSW 3K8S 2VV0 2ZK4 2ZK3 4PWL 4PVU 4O8F 3HO0 3B3K 3VJI 2ZK1 3CDS 1NYX 6AN1 5AZV 3OSI 3ADT 5DV3 5DV8 2VV2 3ADU 5DV6 3CDP 2OM9 4FGY 5WR0 4JAZ 2VV3 1WM0 4PRG 3PRG 5DSH 3DZY 3E00 3DZU 2VV1 2QMV
Thumbnails

Jmol
Position
3p25.2
AA seq 505 aa AA seqDB search
MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaactctgggagattctcctattgacccagaaagcgattccttcactgataca
ctgtctgcaaacatatcacaagaaatgaccatggttgacacagagatgccattctggccc
accaactttgggatcagctccgtggatctctccgtaatggaagaccactcccactccttt
gatatcaagcccttcactactgttgacttctccagcatttctactccacattacgaagac
attccattcacaagaacagatccagtggttgcagattacaagtatgacctgaaacttcaa
gagtaccaaagtgcaatcaaagtggagcctgcatctccaccttattattctgagaagact
cagctctacaataagcctcatgaagagccttccaactccctcatggcaattgaatgtcgt
gtctgtggagataaagcttctggatttcactatggagttcatgcttgtgaaggatgcaag
ggtttcttccggagaacaatcagattgaagcttatctatgacagatgtgatcttaactgt
cggatccacaaaaaaagtagaaataaatgtcagtactgtcggtttcagaaatgccttgca
gtggggatgtctcataatgccatcaggtttgggcggatgccacaggccgagaaggagaag
ctgttggcggagatctccagtgatatcgaccagctgaatccagagtccgctgacctccgg
gccctggcaaaacatttgtatgactcatacataaagtccttcccgctgaccaaagcaaag
gcgagggcgatcttgacaggaaagacaacagacaaatcaccattcgttatctatgacatg
aattccttaatgatgggagaagataaaatcaagttcaaacacatcacccccctgcaggag
cagagcaaagaggtggccatccgcatctttcagggctgccagtttcgctccgtggaggct
gtgcaggagatcacagagtatgccaaaagcattcctggttttgtaaatcttgacttgaac
gaccaagtaactctcctcaaatatggagtccacgagatcatttacacaatgctggcctcc
ttgatgaataaagatggggttctcatatccgagggccaaggcttcatgacaagggagttt
ctaaagagcctgcgaaagccttttggtgactttatggagcccaagtttgagtttgctgtg
aagttcaatgcactggaattagatgacagcgacttggcaatatttattgctgtcattatt
ctcagtggagaccgcccaggtttgctgaatgtgaagcccattgaagacattcaagacaac
ctgctacaagccctggagctccagctgaagctgaaccaccctgagtcctcacagctgttt
gccaagctgctccagaaaatgacagacctcagacagattgtcacggaacacgtgcagcta
ctgcaggtgatcaagaagacggagacagacatgagtcttcacccgctcctgcaggagatc
tacaaggacttgtactag

DBGET integrated database retrieval system