KEGG   Homo sapiens (human): 5473Help
Entry
5473              CDS       T01001                                 

Gene name
PPBP, B-TG1, Beta-TG, CTAP-III, CTAP3, CTAPIII, CXCL7, LA-PF4, LDGF, MDGF, NAP-2, PBP, SCYB7, TC1, TC2, TGB, TGB1, THBGB, THBGB1
Definition
pro-platelet basic protein (chemokine (C-X-C motif) ligand 7)
Orthology
K10029  
platelet basic protein
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    5473 (PPBP)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    5473 (PPBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q12-q13
AA seq 128 aa AA seqDB search
MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAE
LRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKK
LAGDESAD
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcagacttgataccaccccttcctgtaacagtgcgagaccacttcatgccttg
caggtgctgctgcttctgtcattgctgctgactgctctggcttcctccaccaaaggacaa
actaagagaaacttggcgaaaggcaaagaggaaagtctagacagtgacttgtatgctgaa
ctccgctgcatgtgtataaagacaacctctggaattcatcccaaaaacatccaaagtttg
gaagtgatcgggaaaggaacccattgcaaccaagtcgaagtgatagccacactgaaggat
gggaggaaaatctgcctggacccagatgctcccagaatcaagaaaattgtacagaaaaaa
ttggcaggtgatgaatctgctgattaa

DBGET integrated database retrieval system