KEGG   Homo sapiens (human): 54928Help
Entry
54928             CDS       T01001                                 

Gene name
IMPAD1, GPAPP, IMP_3, IMP-3, IMPA3
Definition
(RefSeq) inositol monophosphatase domain containing 1
  KO
K15759  inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa00920  Sulfur metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    54928 (IMPAD1)
  Energy metabolism
   00920 Sulfur metabolism
    54928 (IMPAD1)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    54928 (IMPAD1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     54928 (IMPAD1)
    3.1.3.25  inositol-phosphate phosphatase
     54928 (IMPAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-GeneID: 54928
NCBI-ProteinID: NP_060283
OMIM: 614010
HGNC: 26019
Ensembl: ENSG00000104331
Vega: OTTHUMG00000164415
Pharos: Q9NX62(Tdark)
UniProt: Q9NX62 A0A024R7W0
Position
8q12.1
AA seq 359 aa AA seqDB search
MAPMGIRLSPLGVAVFCLLGLGVLYHLYSGFLAGRFSLFGLGGEPGGGAAGPAAAADGGT
VDLREMLAVSVLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL
LKTAFPSVQINTEEHVDAADQEVILWDHKIPEDILKEVTTPKEVPAESVTVWIDPLDATQ
EYTEDLRKYVTTMVCVAVNGKPMLGVIHKPFSEYTAWAMVDGGSNVKARSSYNEKTPRIV
VSRSHSGMVKQVALQTFGNQTTIIPAGGAGYKVLALLDVPDKSQEKADLYIHVTYIKKWD
ICAGNAILKALGGHMTTLSGEEISYTGSDGIEGGLLASIRMNHQALVRKLPDLEKTGHK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcccccatgggcatccgcctttccccactgggggtggcagtgttttgcctgctgggg
ctcggcgtgctctaccacctctactcgggcttcttggccggccgcttcagcctcttcggc
ctgggcggcgagcctggcggcggcgcggcggggcccgcggccgcggccgatgggggcacc
gtggacttgcgcgagatgctggctgtgtcagtgctggccgcagtccgcggcggcgacgag
gtgaggcgcgtccgcgagagcaacgtcctccacgagaagtccaaggggaagacgcgcgag
ggagccgaggacaagatgaccagcggcgacgtgctgtccaaccgcaagatgttctacctg
ctcaagaccgccttccccagcgtccagattaatactgaggaacacgtggatgcagctgat
caggaggttatcttgtgggatcataagattcctgaggatatcctaaaggaagtaactact
cctaaagaggtaccagcagaaagtgttactgtctggattgacccacttgatgctacacag
gaatatacagaggatcttcgaaagtacgtcactactatggtgtgtgtggctgtaaatggt
aaacccatgctaggagttatacataagccattttccgaatatacagcttgggcaatggta
gatggtggttcaaatgtgaaagcccgctcttcctacaatgagaagaccccaaggatcgtt
gtgtctcgttcccattcagggatggtcaaacaggtcgctcttcagacttttggaaaccag
actacaattatcccagctggtggtgctggttataaagttttagcacttttggatgtgcct
gataagagtcaagaaaaagctgatttatacatccatgtgacatacatcaaaaagtgggat
atatgtgctggtaatgccatcttaaaagccctaggggggcatatgactaccctgagtggt
gaagaaatcagttacactggttcagacggcattgaagggggactccttgctagcatcaga
atgaaccaccaggccctggtcagaaaactcccagatctagaaaagacaggacataaatga

DBGET integrated database retrieval system