KEGG   Homo sapiens (human): 5501Help
Entry
5501              CDS       T01001                                 

Gene name
PPP1CC, PP-1G, PP1C, PPP1G
Definition
protein phosphatase 1, catalytic subunit, gamma isozyme (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
cGMP-PKG signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Hippo signaling pathway
Focal adhesion
Platelet activation
Long-term potentiation
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Oxytocin signaling pathway
Amphetamine addiction
Alcoholism
Herpes simplex infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    5501 (PPP1CC)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    5501 (PPP1CC)
   04022 cGMP - PKG signaling pathway
    5501 (PPP1CC)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    5501 (PPP1CC)
  Cell growth and death
   04114 Oocyte meiosis
    5501 (PPP1CC)
  Cell communication
   04510 Focal adhesion
    5501 (PPP1CC)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5501 (PPP1CC)
  Endocrine system
   04910 Insulin signaling pathway
    5501 (PPP1CC)
   04921 Oxytocin signaling pathway
    5501 (PPP1CC)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5501 (PPP1CC)
   04270 Vascular smooth muscle contraction
    5501 (PPP1CC)
  Nervous system
   04728 Dopaminergic synapse
    5501 (PPP1CC)
   04720 Long-term potentiation
    5501 (PPP1CC)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5501 (PPP1CC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    5501 (PPP1CC)
  Substance dependence
   05031 Amphetamine addiction
    5501 (PPP1CC)
   05034 Alcoholism
    5501 (PPP1CC)
  Infectious diseases
   05168 Herpes simplex infection
    5501 (PPP1CC)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5501 (PPP1CC)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     5501 (PPP1CC)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     5501 (PPP1CC)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    5501 (PPP1CC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.1-q24.2
AA seq 337 aa AA seqDB search
MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRVASGLNPSIQKASNYRNNTVLYE
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttagataaactcaacatcgacagcattatccaacggctgctggaagtgaga
gggtccaagcctggtaagaatgtccagcttcaggagaatgaaatcagaggactgtgctta
aagtctcgtgaaatctttctcagtcagcctatcctactagaacttgaagcaccactcaaa
atatgtggtgacatccatggacaatactatgatttgctgcgactttttgagtacggtggt
ttcccaccagaaagcaactacctgtttcttggggactatgtggacaggggaaagcagtca
ttggagacgatctgcctcttactggcctacaaaataaaatatcctgagaatttttttctt
ctcagagggaaccatgaatgtgccagcatcaacagaatttatggattttatgatgaatgt
aaaagaagatacaacattaaactatggaaaactttcacagactgttttaactgtttaccg
atagcagccatcgtggatgagaagatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgcgaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggatatgaattttttgcaaag
aggcagttggtcactctgttttctgcgcccaattattgcggagagtttgacaatgcaggt
gccatgatgagtgtggatgaaacactaatgtgttcttttcagattttaaagcctgcagag
aaaaagaagccaaatgccacgagacctgtaacgcctccaagggttgcatcaggcctgaac
ccgtccattcagaaagcttcaaattatagaaacaatactgttctatacgagtga

DBGET integrated database retrieval system