KEGG   Homo sapiens (human): 55081Help
Entry
55081             CDS       T01001                                 

Gene name
IFT57, ESRRBL1, HIPPI, MHS4R2
Definition
(RefSeq) intraflagellar transport 57
  KO
K04638  
intraflagellar transport protein 57
Organism
hsa  Homo sapiens (human)
Pathway
Huntington's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    55081 (IFT57)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Intraflagellar transport (IFT) complex B
    55081 (IFT57)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NWB7(Tbio)
UniProt: 
Position
3q13.12-q13.13
AA seq 429 aa AA seqDB search
MTAALAVVTTSGLEDGVPRSRGEGTGEVVLERGPGAAYHMFVVMEDLVEKLKLLRYEEEF
LRKSNLKAPSRHYFALPTNPGEQFYMFCTLAAWLINKAGRPFEQPQEYDDPNATISNILS
ELRSFGRTADFPPSKLKSGYGEHVCYVLDCFAEEALKYIGFTWKRPIYPVEELEEESVAE
DDAELTLNKVDEEFVEEETDNEENFIDLNVLKAQTYHLDMNETAKQEDILESTTDAAEWS
LEVERVLPQLKVTIRTDNKDWRIHVDQMHQHRSGIESALKETKGFLDKLHNEITRTLEKI
SSREKYINNQLENLVQEYRAAQAQLSEAKERYQQGNGGVTERTRLLSEVMEELEKVKQEM
EEKGSSMTDGAPLVKIKQSLTKLKQETVEMDIRIGIVEHTLLQSKLKEKSNMTRNMHATV
IPEPATGFY
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgctctggccgtcgtcacgacgtcgggtttggaagatggggtgcctaggtcc
cgtggcgaagggaccggggaagtggtcttggagcgggggcccggcgcggcctaccacatg
ttcgtggtgatggaggacttggtggagaagctgaagctgctccgctacgaggaggagttc
ctccggaagagcaacctgaaggccccgtccagacactattttgcactgcctaccaaccct
ggcgaacagttctacatgttttgtactcttgctgcttggttgattaataaagcgggacgt
ccctttgagcagcctcaagaatatgatgaccctaatgcaacaatatctaacatactatcc
gagcttcggtcatttggaagaactgcagattttcctccttcaaaattaaagtcaggttat
ggagaacatgtatgctatgttcttgattgcttcgctgaagaagcattgaaatatattggt
ttcacctggaaaaggccaatatacccagtagaagaattagaagaagaaagcgttgcagaa
gatgatgcagaattaacattaaataaagtggatgaagaatttgtggaagaagagacagat
aatgaagaaaactttattgatctcaacgttttaaaggcccagacatatcacttggatatg
aacgagactgccaaacaagaagatattttggaatccacaacagatgctgcagaatggagc
ctagaagtggaacgtgtactaccgcaactgaaagtcacgattaggactgacaataaggat
tggagaatccatgttgaccaaatgcaccagcacagaagtggaattgaatctgctctaaag
gagaccaagggatttttggacaaactccataatgaaattactaggactttggaaaagatc
agcagccgagaaaagtacatcaacaatcagcttgagaatttggttcaagaatatcgtgca
gctcaagcccagctgagtgaggcaaaggagcgataccagcagggaaatggaggagtgacg
gaaagaaccagactcctctctgaggttatggaagaattagaaaaggtaaaacaagaaatg
gaagaaaagggcagcagcatgactgatggtgctcctttggtgaagattaaacagagctta
acaaaactgaagcaagaaactgtagagatggacattagaattggcattgtggaacacaca
ctactccaatcaaagctgaaggagaagtccaacatgactaggaacatgcatgccacagtt
attccagaaccagcaacaggcttttattaa

DBGET integrated database retrieval system