KEGG   Homo sapiens (human): 551Help
Entry
551               CDS       T01001                                 

Gene name
AVP, ADH, ARVP, AVP-NPII, AVRP, VP
Definition
arginine vasopressin
Orthology
K05242  
arginine vasopressin
Organism
hsa  Homo sapiens (human)
Pathway
Vasopressin-regulated water reabsorption
Disease
H00253  
Neurohypophyseal diabetes insipidus (NPDI)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    551 (AVP)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    551 (AVP)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    551 (AVP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20p13
AA seq 164 aa AA seqDB search
MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCA
DELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGF
HRRARASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacaccatgctgcccgcctgcttcctcggcctactggccttctcctccgcgtgc
tacttccagaactgcccgaggggcggcaagagggccatgtccgacctggagctgagacag
tgcctcccctgcggccccgggggcaaaggccgctgcttcgggcccagcatctgctgcgcg
gacgagctgggctgcttcgtgggcacggctgaggcgctgcgctgccaggaggagaactac
ctgccgtcgccctgccagtccggccagaaggcgtgcgggagcgggggccgctgcgccgcc
ttcggcgtttgctgcaacgacgagagctgcgtgaccgagcccgagtgccgcgagggcttt
caccgccgcgcccgcgccagcgaccggagcaacgccacgcagctggacgggccggccggg
gccttgctgctgcggctggtgcagctggccggggcgcccgagcccttcgagcccgcccag
cccgacgcctactga

DBGET integrated database retrieval system