KEGG   Homo sapiens (human): 55107Help
Entry
55107             CDS       T01001                                 

Gene name
ANO1, DOG1, ORAOV2, TAOS2, TMEM16A
Definition
(RefSeq) anoctamin 1
  KO
K19496  
anoctamin-1
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Chloride channels
  Calcium activated chloride channel
   55107 (ANO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.3
AA seq 986 aa AA seqDB search
MRVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECKYGLYFRDGRR
KVDYILVYHHKRPSGNRTLVRRVQHSDTPSGARSVKQDHPLPGKGASLDAGSGEPPMDYH
EDDKRFRREEYEGNLLEAGLELERDEDTKIHGVGFVKIHAPWNVLCREAEFLKLKMPTKK
MYHINETRGLLKKINSVLQKITDPIQPKVAEHRPQTMKRLSYPFSREKQHLFDLSDKDSF
FDSKTRSTIVYEILKRTTCTKAKYSMGITSLLANGVYAAAYPLHDGDYNGENVEFNDRKL
LYEEWARYGVFYKYQPIDLVRKYFGEKIGLYFAWLGVYTQMLIPASIVGIIVFLYGCATM
DENIPSMEMCDQRHNITMCPLCDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWA
ATFMEHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLKKESRNKEKRRHI
PEESTNKWKQRVKTAMAGVKLTDKVKLTWRDRFPAYLTNLVSIIFMIAVTFAIVLGVIIY
RISMAAALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEK
SFEERLIFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRMEECAPGGCLMEL
CIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKLKQQSPPDHEECVKRKQRYEVDYNLE
PFAGLTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAVRA
KDIGIWYNILRGIGKLAVIINAFVISFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNV
SDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLAFVIVFQNL
VMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDEPPC
NHHNTKACPDSLGSPAPSHAYHGGVL
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcaacgagaagtactcgacgctcccggccgaggaccgcagcgtccacatcatc
aacatctgcgccatcgaggacatcggctacctgccgtccgagggcacgctgctgaactcc
ttatctgtggaccctgatgccgagtgcaagtatggcctgtacttcagggacggccggcgc
aaggtggactacatcctggtgtaccatcacaagaggccctcgggcaaccggaccctggtc
aggagggtgcagcacagcgacaccccctctggggctcgcagcgtcaagcaggaccacccc
ctgccgggcaagggggcgtcgctggatgcaggctcgggggagcccccgatggactaccac
gaggatgacaagcgcttccgcagggaggagtacgagggcaacctcctggaggcgggcctg
gagctggagcgggacgaggacactaaaatccacggagtcgggtttgtgaaaatccatgcc
ccctggaacgtgctgtgcagagaggccgagtttctgaaactgaagatgccgacgaagaag
atgtaccacattaatgagacccgtggcctcctgaaaaaaatcaactctgtgctccagaaa
atcacagatcccatccagcccaaagtggctgagcacaggccccagaccatgaagagactc
tcctatcccttctcccgggagaagcagcatctatttgacttgtctgataaggattccttt
ttcgacagcaaaacccggagcacgattgtctatgagatcttgaagagaacgacgtgtaca
aaggccaagtacagcatgggcatcacgagcctgctggccaatggtgtgtacgcggctgca
tacccactgcacgatggagactacaacggtgaaaacgtcgagttcaacgacagaaaactc
ctgtacgaagagtgggcacgctatggagttttctataagtaccagcccatcgacctggtc
aggaagtattttggggagaagatcggcctgtacttcgcctggctgggcgtgtacacccag
atgctcatccctgcctccatcgtgggaatcattgtcttcctgtacggatgcgccaccatg
gatgaaaacatccccagcatggagatgtgtgaccagagacacaatatcaccatgtgcccg
ctttgcgacaagacctgcagctactggaagatgagctcagcctgcgccacggcccgcgcc
agccacctcttcgacaaccccgccacggtcttcttctctgtcttcatggccctctgggct
gccaccttcatggagcactggaagcggaaacagatgcgactcaactaccgctgggacctc
acgggctttgaagaggaagaggaggctgtcaaggatcatcctagagctgaatacgaagcc
agagtcttggagaagtctctgaagaaagagtccagaaacaaagagaagcgccggcatatt
ccagaggagtcaacaaacaaatggaagcagagggttaagacagccatggcgggggtgaaa
ttgactgacaaagtgaagctgacatggagagatcggttcccagcctacctcactaacttg
gtctccatcatcttcatgattgcagtgacgtttgccatcgtcctcggcgtcatcatctac
agaatctccatggccgccgccttggccatgaactcctccccctccgtgcggtccaacatc
cgggtcacagtcacagccaccgcagtcatcatcaacctagtggtcatcatcctcctggac
gaggtgtatggctgcatagcccgatggctcaccaagatcgaggtcccaaagacggagaaa
agctttgaggagaggctgatcttcaaggctttcctgctgaagtttgtgaattcctacacc
cccatcttttacgtggcgttcttcaaaggccggtttgttggacgcccgggcgactacgtg
tacattttccgttccttccgaatggaagagtgtgcgccagggggctgcctgatggagcta
tgcatccagctcagcatcatcatgctggggaaacagctgatccagaacaacctgttcgag
atcggcatcccgaagatgaagaagctcatccgctacctgaagctgaagcagcagagcccc
cctgaccacgaggagtgtgtgaagaggaaacagcggtacgaggtggattacaacctggag
cccttcgcgggcctcaccccagagtacatggaaatgatcatccagtttggcttcgtcacc
ctgtttgtcgcctccttccccctggccccactgtttgcgctgctgaacaacatcatcgag
atccgcctggacgccaaaaagtttgtcactgagctccgaaggccggtagctgtcagagcc
aaagacatcggaatctggtacaatatcctcagaggcattgggaagcttgctgtcatcatc
aatgccttcgtgatctccttcacgtctgacttcatcccgcgcctggtgtacctctacatg
tacagtaagaacgggaccatgcacggcttcgtcaaccacaccctctcctccttcaacgtc
agtgacttccagaacggcacggcccccaatgaccccctggacctgggctacgaggtgcag
atctgcaggtataaagactaccgagagccgccgtggtcggaaaacaagtacgacatctcc
aaggacttctgggccgtcctggcagcccggctggcgtttgtcatcgtcttccagaacctg
gtcatgttcatgagcgactttgtggactgggtcatcccggacatccccaaggacatcagc
cagcagatccacaaggagaaggtgctcatggtggagctgttcatgcgggaggagcaagac
aagcagcagctgctggaaacctggatggagaaggagcggcagaaggacgagccgccgtgc
aaccaccacaacaccaaagcctgcccagacagcctcggcagcccagcccccagccatgcc
taccacgggggcgtcctgtag

DBGET integrated database retrieval system