KEGG   Homo sapiens (human): 55135Help
Entry
55135             CDS       T01001                                 

Gene name
WRAP53, DKCB3, TCAB1, WDR79
Definition
WD repeat containing, antisense to TP53
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1
AA seq 548 aa AA seqDB search
MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAG
SAVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANG
PELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPD
GSCILTNSADNILRIYNLPPELYHEGEQVEYAEMVPVLRMVEGDTIYDYCWYSLMSSAQP
DTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTV
RVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLYACGSYGRSLGLYAWDDGSPL
ALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFD
LDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATAS
GQRVFPEPTESGDEGEELGLPLLSTRHVHLECRLQLWWCGGAPDSSIPDDHQGEKGQGGT
EGGVGELI
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaagactttggagactcaaccgttagctccggactgctgtccttcagaccaggaccca
gctccagcccatccttctccccacgcttccccgatgaataaaaatgcggactctgaactg
atgccaccgcctcccgaaaggggggatccgccccggttgtccccagatcctgtggctggc
tcagctgtgtcccaggagctacgggagggggacccagtttctctctccactcccctggaa
acagagtttggttcccctagtgagttgagtcctcgaatcgaggagcaagaactttctgaa
aatacaagccttcctgcagaagaagcaaacgggagcctttctgaagaagaagcgaacggg
ccagagttggggtctggaaaagccatggaagatacctctggggaacccgctgcagaggac
gagggagacaccgcttggaactacagcttctcccagctgcctcgatttctcagtggttcc
tggtcagagttcagcacccaacctgagaacttcttgaaaggctgtaagtgggctcctgac
ggttcctgcatcttgaccaatagtgctgataacatcttgcgaatttataacctgccccca
gagctgtaccatgagggggagcaggtggaatatgcagaaatggtccctgtccttcgaatg
gtggaaggtgataccatctatgattactgctggtattctctgatgtcctcagcccagcca
gacacctcctacgtggccagcagcagccgggagaacccgattcatatctgggacgcattc
actggagagctccgggcttcctttcgcgcctacaaccacctggatgagctgacggcagcc
cattcgctctgcttctccccggatggctcccagctcttctgtggcttcaaccggactgtg
cgtgttttttccacggcccggcctggccgagactgcgaggtccgagccacatttgcaaaa
aagcagggccagagcggcatcatctcctgcatagccttcagcccagcccagcccctctat
gcctgtggctcctacggccgctccctgggtctgtatgcctgggatgatggctcccctctc
gccttgctgggagggcaccaagggggcatcacccacctctgctttcatcccgatggcaac
cgcttcttctcaggagcccgcaaggatgctgagctcctgtgctgggatctccggcagtct
ggttacccactgtggtccctgggtcgagaggtgaccaccaatcagcgcatctacttcgat
ctggacccgaccgggcagttcctagtgagtggcagcacgagcggggctgtctctgtgtgg
gacacggacgggcctggcaatgatgggaagccggagcccgtgttgagttttctgccccag
aaggactgcaccaatggcgtgagcctgcaccctagcctgcctctcctggccactgcctcc
ggtcagcgtgtgtttcctgagcccacagagagtggggacgaaggagaggagctgggcctt
cccttgctctccacgcgccacgtccaccttgaatgtcggcttcagctctggtggtgtggg
ggggcgccagactccagcatccctgatgatcaccagggcgagaaagggcagggaggaacg
gagggaggtgtgggtgagctgatataa

DBGET integrated database retrieval system