KEGG   Homo sapiens (human): 55135Help
Entry
55135             CDS       T01001                                 

Gene name
WRAP53, DKCB3, TCAB1, WDR79
Definition
(RefSeq) WD repeat containing antisense to TP53
Organism
hsa  Homo sapiens (human)
Disease
H00507  
Dyskeratosis congenita (DC)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9BUR4(Tbio)
UniProt: 
Position
17p13.1
AA seq 548 aa AA seqDB search
MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAG
SAVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANG
PELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPD
GSCILTNSADNILRIYNLPPELYHEGEQVEYAEMVPVLRMVEGDTIYDYCWYSLMSSAQP
DTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTV
RVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLYACGSYGRSLGLYAWDDGSPL
ALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFD
LDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATAS
GQRVFPEPTESGDEGEELGLPLLSTRHVHLECRLQLWWCGGAPDSSIPDDHQGEKGQGGT
EGGVGELI
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaagactttggagactcaaccgttagctccggactgctgtccttcagaccaggaccca
gctccagcccatccttctccccacgcttccccgatgaataaaaatgcggactctgaactg
atgccaccgcctcccgaaaggggggatccgccccggttgtccccagatcctgtggctggc
tcagctgtgtcccaggagctacgggagggggacccagtttctctctccactcccctggaa
acagagtttggttcccctagtgagttgagtcctcgaatcgaggagcaagaactttctgaa
aatacaagccttcctgcagaagaagcaaacgggagcctttctgaagaagaagcgaacggg
ccagagttggggtctggaaaagccatggaagatacctctggggaacccgctgcagaggac
gagggagacaccgcttggaactacagcttctcccagctgcctcgatttctcagtggttcc
tggtcagagttcagcacccaacctgagaacttcttgaaaggctgtaagtgggctcctgac
ggttcctgcatcttgaccaatagtgctgataacatcttgcgaatttataacctgccccca
gagctgtaccatgagggggagcaggtggaatatgcagaaatggtccctgtccttcgaatg
gtggaaggtgataccatctatgattactgctggtattctctgatgtcctcagcccagcca
gacacctcctacgtggccagcagcagccgggagaacccgattcatatctgggacgcattc
actggagagctccgggcttcctttcgcgcctacaaccacctggatgagctgacggcagcc
cattcgctctgcttctccccggatggctcccagctcttctgtggcttcaaccggactgtg
cgtgttttttccacggcccggcctggccgagactgcgaggtccgagccacatttgcaaaa
aagcagggccagagcggcatcatctcctgcatagccttcagcccagcccagcccctctat
gcctgtggctcctacggccgctccctgggtctgtatgcctgggatgatggctcccctctc
gccttgctgggagggcaccaagggggcatcacccacctctgctttcatcccgatggcaac
cgcttcttctcaggagcccgcaaggatgctgagctcctgtgctgggatctccggcagtct
ggttacccactgtggtccctgggtcgagaggtgaccaccaatcagcgcatctacttcgat
ctggacccgaccgggcagttcctagtgagtggcagcacgagcggggctgtctctgtgtgg
gacacggacgggcctggcaatgatgggaagccggagcccgtgttgagttttctgccccag
aaggactgcaccaatggcgtgagcctgcaccctagcctgcctctcctggccactgcctcc
ggtcagcgtgtgtttcctgagcccacagagagtggggacgaaggagaggagctgggcctt
cccttgctctccacgcgccacgtccaccttgaatgtcggcttcagctctggtggtgtggg
ggggcgccagactccagcatccctgatgatcaccagggcgagaaagggcagggaggaacg
gagggaggtgtgggtgagctgatataa

DBGET integrated database retrieval system