KEGG   Homo sapiens (human): 5515Help
Entry
5515              CDS       T01001                                 

Gene name
PPP2CA, PP2Ac, PP2CA, PP2Calpha, RP-C
Definition
(RefSeq) protein phosphatase 2 catalytic subunit alpha
  KO
K04382  
serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Sphingolipid signaling pathway
Oocyte meiosis
Autophagy - other
Autophagy - animal
PI3K-Akt signaling pathway
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
TGF-beta signaling pathway
Hippo signaling pathway
Tight junction
Dopaminergic synapse
Long-term depression
Chagas disease (American trypanosomiasis)
Hepatitis C
Human papillomavirus infection
Drug target
Fostriecin sodium: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    5515 (PPP2CA)
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    5515 (PPP2CA)
   04390 Hippo signaling pathway
    5515 (PPP2CA)
   04071 Sphingolipid signaling pathway
    5515 (PPP2CA)
   04151 PI3K-Akt signaling pathway
    5515 (PPP2CA)
   04152 AMPK signaling pathway
    5515 (PPP2CA)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    5515 (PPP2CA)
   04136 Autophagy - other eukaryotes
    5515 (PPP2CA)
  Cell growth and death
   04114 Oocyte meiosis
    5515 (PPP2CA)
  Cellular community - eukaryotes
   04530 Tight junction
    5515 (PPP2CA)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5515 (PPP2CA)
  Nervous system
   04728 Dopaminergic synapse
    5515 (PPP2CA)
   04730 Long-term depression
    5515 (PPP2CA)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    5515 (PPP2CA)
   05165 Human papillomavirus infection
    5515 (PPP2CA)
   05142 Chagas disease (American trypanosomiasis)
    5515 (PPP2CA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5515 (PPP2CA)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     5515 (PPP2CA)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5515 (PPP2CA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5515 (PPP2CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P67775(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.1
AA seq 309 aa AA seqDB search
MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggacgagaaggtgttcaccaaggagctggaccagtggatcgagcagctgaacgagtgc
aagcagctgtccgagtcccaggtcaagagcctctgcgagaaggctaaagaaatcctgaca
aaagaatccaacgtgcaagaggttcgatgtccagttactgtctgtggagatgtgcatggg
caatttcatgatctcatggaactgtttagaattggtggcaaatcaccagatacaaattac
ttgtttatgggagattatgttgacagaggatattattcagttgaaacagttacactgctt
gtagctcttaaggttcgttaccgtgaacgcatcaccattcttcgagggaatcatgagagc
agacagatcacacaagtttatggtttctatgatgaatgtttaagaaaatatggaaatgca
aatgtttggaaatattttacagatctttttgactatcttcctctcactgccttggtggat
gggcagatcttctgtctacatggtggtctctcgccatctatagatacactggatcatatc
agagcacttgatcgcctacaagaagttccccatgagggtccaatgtgtgacttgctgtgg
tcagatccagatgaccgtggtggttggggtatatctcctcgaggagctggttacaccttt
gggcaagatatttctgagacatttaatcatgccaatggcctcacgttggtgtctagagct
caccagctagtgatggagggatataactggtgccatgaccggaatgtagtaacgattttc
agtgctccaaactattgttatcgttgtggtaaccaagctgcaatcatggaacttgacgat
actctaaaatactctttcttgcagtttgacccagcacctcgtagaggcgagccacatgtt
actcgtcgtaccccagactacttcctgtaa

DBGET integrated database retrieval system