KEGG   Homo sapiens (human): 5515Help
Entry
5515              CDS       T01001                                 

Gene name
PPP2CA, PP2Ac, PP2CA, PP2Calpha, RP-C
Definition
(RefSeq) protein phosphatase 2 catalytic subunit alpha (EC:3.1.3.16)
  KO
K04382  
serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Sphingolipid signaling pathway
Oocyte meiosis
PI3K-Akt signaling pathway
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
TGF-beta signaling pathway
Hippo signaling pathway
Tight junction
Dopaminergic synapse
Long-term depression
Chagas disease (American trypanosomiasis)
Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    5515 (PPP2CA)
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    5515 (PPP2CA)
   04390 Hippo signaling pathway
    5515 (PPP2CA)
   04071 Sphingolipid signaling pathway
    5515 (PPP2CA)
   04151 PI3K-Akt signaling pathway
    5515 (PPP2CA)
   04152 AMPK signaling pathway
    5515 (PPP2CA)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    5515 (PPP2CA)
  Cellular community
   04530 Tight junction
    5515 (PPP2CA)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5515 (PPP2CA)
  Nervous system
   04728 Dopaminergic synapse
    5515 (PPP2CA)
   04730 Long-term depression
    5515 (PPP2CA)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    5515 (PPP2CA)
   05142 Chagas disease (American trypanosomiasis)
    5515 (PPP2CA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5515 (PPP2CA)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     5515 (PPP2CA)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5515 (PPP2CA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5515 (PPP2CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.1
AA seq 309 aa AA seqDB search
MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggacgagaaggtgttcaccaaggagctggaccagtggatcgagcagctgaacgagtgc
aagcagctgtccgagtcccaggtcaagagcctctgcgagaaggctaaagaaatcctgaca
aaagaatccaacgtgcaagaggttcgatgtccagttactgtctgtggagatgtgcatggg
caatttcatgatctcatggaactgtttagaattggtggcaaatcaccagatacaaattac
ttgtttatgggagattatgttgacagaggatattattcagttgaaacagttacactgctt
gtagctcttaaggttcgttaccgtgaacgcatcaccattcttcgagggaatcatgagagc
agacagatcacacaagtttatggtttctatgatgaatgtttaagaaaatatggaaatgca
aatgtttggaaatattttacagatctttttgactatcttcctctcactgccttggtggat
gggcagatcttctgtctacatggtggtctctcgccatctatagatacactggatcatatc
agagcacttgatcgcctacaagaagttccccatgagggtccaatgtgtgacttgctgtgg
tcagatccagatgaccgtggtggttggggtatatctcctcgaggagctggttacaccttt
gggcaagatatttctgagacatttaatcatgccaatggcctcacgttggtgtctagagct
caccagctagtgatggagggatataactggtgccatgaccggaatgtagtaacgattttc
agtgctccaaactattgttatcgttgtggtaaccaagctgcaatcatggaacttgacgat
actctaaaatactctttcttgcagtttgacccagcacctcgtagaggcgagccacatgtt
actcgtcgtaccccagactacttcctgtaa

DBGET integrated database retrieval system