KEGG   Homo sapiens (human): 552Help
Entry
552               CDS       T01001                                 

Gene name
AVPR1A, AVPR_V1a, AVPR1, V1aR
Definition
arginine vasopressin receptor 1A
Orthology
K04226  
arginine vasopressin receptor 1A
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Vascular smooth muscle contraction
Drug target
Conivaptan: 
Vasopressin: 
Desmopressin: 
Lypressin: 
Terlipressin: 
Ornipressin: 
Argipressin: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    552 (AVPR1A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    552 (AVPR1A)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    552 (AVPR1A)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Pituitary hormone
   Vasopressin
    552 (AVPR1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q14-q15
AA seq 418 aa AA seqDB search
MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAKLEIAVLAV
TFAVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGP
DWLCRVVKHLQVFGMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVLSFV
LSTPQYFVFSMIEVNNVTKARDCWATFIQPWGSRAYVTWMTGGIFVAPVVILGTCYGFIC
YNIWCNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVKSISRAKIRTVKMTFVIVTAY
IVCWAPFFIIQMWSVWDPMSVWTESENPTITITALLGSLNSCCNPWIYMFFSGHLLQDCV
QSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctctccgccggtcccgacgcggggccctcgggcaactccagcccatggtggcct
ctggccaccggcgctggcaacacaagccgggaggccgaagccctcggggagggcaacggc
ccaccgagggacgtgcgcaacgaggagctggccaaactggagatcgccgtgctggcggtg
actttcgcggtggccgtgctgggcaacagcagcgtactgctggctctgcaccggacgccg
cgcaagacgtcccgcatgcacctcttcatccgacacctcagcctggccgacctggccgtg
gcattcttccaggtgctgccgcaaatgtgctgggacatcacctaccgcttccgcggcccc
gactggctgtgccgcgtggtgaagcacctgcaggtgttcggcatgtttgcgtcggcctac
atgctggtagtcatgacagccgaccgctacatcgcggtgtgccacccgctcaagactctg
caacagcccgcgcgccgctcgcgcctcatgatcgcggccgcctgggtgctgagcttcgtg
ctgagcacgccgcagtacttcgtcttctccatgatcgaggtgaacaatgtcaccaaggcc
cgcgactgctgggccaccttcatccagccctggggttctcgtgcctacgtgacctggatg
acgggcggcatctttgtggcgcccgtggtcatcttgggtacctgctacggcttcatctgc
tacaacatctggtgcaacgtccgcgggaagacggcgtcgcgccagagcaagggtgcagag
caagcgggtgtggccttccaaaaggggttcctgctcgcaccctgtgtcagcagcgtgaag
tccatttcccgggccaagatccgcacggtgaagatgacttttgtgatcgtgacggcttac
atcgtctgctgggcgcctttcttcatcatccagatgtggtctgtctgggatcccatgtcc
gtctggaccgaatcggaaaaccctaccatcaccatcactgcattactgggttccttgaat
agctgctgtaatccctggatatacatgttttttagtggccatctccttcaagactgtgtt
caaagcttcccatgctgccaaaacatgaaggaaaaattcaacaaagaagatactgacagt
atgagcagaagacagactttttattctaacaatcgaagcccaacaaacagtacgggtatg
tggaaggactcgcctaaatcttccaagtccatcaaattcattcctgtttcaacttga

DBGET integrated database retrieval system