KEGG   Homo sapiens (human): 552Help
Entry
552               CDS       T01001                                 

Gene name
AVPR1A, AVPR_V1a, AVPR1, V1aR
Definition
arginine vasopressin receptor 1A
Orthology
K04226  
arginine vasopressin receptor 1A
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Vascular smooth muscle contraction
Drug target
Conivaptan: 
Vasopressin: 
Desmopressin: 
Lypressin: 
Terlipressin: 
Ornipressin: 
Argipressin: 
Other: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q14-q15
AA seq 418 aa AA seqDB search
MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAKLEIAVLAV
TFAVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGP
DWLCRVVKHLQVFGMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVLSFV
LSTPQYFVFSMIEVNNVTKARDCWATFIQPWGSRAYVTWMTGGIFVAPVVILGTCYGFIC
YNIWCNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVKSISRAKIRTVKMTFVIVTAY
IVCWAPFFIIQMWSVWDPMSVWTESENPTITITALLGSLNSCCNPWIYMFFSGHLLQDCV
QSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctctccgccggtcccgacgcggggccctcgggcaactccagcccatggtggcct
ctggccaccggcgctggcaacacaagccgggaggccgaagccctcggggagggcaacggc
ccaccgagggacgtgcgcaacgaggagctggccaaactggagatcgccgtgctggcggtg
actttcgcggtggccgtgctgggcaacagcagcgtactgctggctctgcaccggacgccg
cgcaagacgtcccgcatgcacctcttcatccgacacctcagcctggccgacctggccgtg
gcattcttccaggtgctgccgcaaatgtgctgggacatcacctaccgcttccgcggcccc
gactggctgtgccgcgtggtgaagcacctgcaggtgttcggcatgtttgcgtcggcctac
atgctggtagtcatgacagccgaccgctacatcgcggtgtgccacccgctcaagactctg
caacagcccgcgcgccgctcgcgcctcatgatcgcggccgcctgggtgctgagcttcgtg
ctgagcacgccgcagtacttcgtcttctccatgatcgaggtgaacaatgtcaccaaggcc
cgcgactgctgggccaccttcatccagccctggggttctcgtgcctacgtgacctggatg
acgggcggcatctttgtggcgcccgtggtcatcttgggtacctgctacggcttcatctgc
tacaacatctggtgcaacgtccgcgggaagacggcgtcgcgccagagcaagggtgcagag
caagcgggtgtggccttccaaaaggggttcctgctcgcaccctgtgtcagcagcgtgaag
tccatttcccgggccaagatccgcacggtgaagatgacttttgtgatcgtgacggcttac
atcgtctgctgggcgcctttcttcatcatccagatgtggtctgtctgggatcccatgtcc
gtctggaccgaatcggaaaaccctaccatcaccatcactgcattactgggttccttgaat
agctgctgtaatccctggatatacatgttttttagtggccatctccttcaagactgtgtt
caaagcttcccatgctgccaaaacatgaaggaaaaattcaacaaagaagatactgacagt
atgagcagaagacagactttttattctaacaatcgaagcccaacaaacagtacgggtatg
tggaaggactcgcctaaatcttccaagtccatcaaattcattcctgtttcaacttga

DBGET integrated database retrieval system