KEGG   Homo sapiens (human): 5521Help
Entry
5521              CDS       T01001                                 

Gene name
PPP2R2B, B55BETA, PP2AB55BETA, PP2ABBETA, PP2APR55B, PP2APR55BETA, PR2AB55BETA, PR2ABBETA, PR2APR55BETA, PR52B, PR55-BETA, PR55BETA, SCA12
Definition
(RefSeq) protein phosphatase 2 regulatory subunit Bbeta
  KO
K04354  
serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Sphingolipid signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
Hippo signaling pathway
Tight junction
Dopaminergic synapse
Chagas disease (American trypanosomiasis)
Hepatitis C
Disease
H00063  
Spinocerebellar ataxia (SCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    5521 (PPP2R2B)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    5521 (PPP2R2B)
   04071 Sphingolipid signaling pathway
    5521 (PPP2R2B)
   04151 PI3K-Akt signaling pathway
    5521 (PPP2R2B)
   04152 AMPK signaling pathway
    5521 (PPP2R2B)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    5521 (PPP2R2B)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5521 (PPP2R2B)
  Nervous system
   04728 Dopaminergic synapse
    5521 (PPP2R2B)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    5521 (PPP2R2B)
   05142 Chagas disease (American trypanosomiasis)
    5521 (PPP2R2B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5521 (PPP2R2B)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5521 (PPP2R2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q00005(Tbio)
UniProt: 
Position
5q32
AA seq 446 aa AA seqDB search
MKCFSRYLPYIFRPPNTILSSSCHTEADIISTVEFNHTGELLATGDKGGRVVIFQREQES
KNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKL
WKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHIN
SISVNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHPHHCNT
FVYSSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIM
TRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGS
YNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILH
TAWHPSENIIAVAATNNLYIFQDKVN
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgcttctctcgttacctgccttacatcttcagacctccgaacaccatcctttct
tccagctgccacacagaagctgacattatctctacggtagaattcaaccacacgggagaa
ttactagcgacaggggacaaggggggtcgggttgtaatatttcaacgagagcaggagagt
aaaaatcaggttcatcgtaggggtgaatacaatgtttacagcacattccagagccatgaa
cccgagttcgattacctgaagagtttagaaatagaagaaaaaatcaataaaataagatgg
ctcccccagcagaatgcagcttactttcttctgtctactaatgataaaactgtgaagctg
tggaaagtcagcgagcgtgataagaggccagaaggctacaatctgaaagatgaggagggc
cggctccgggatcctgccaccatcacaaccctgcgggtgcctgtcctgagacccatggac
ctgatggtggaggccaccccacgaagagtatttgccaacgcacacacatatcacatcaac
tccatatctgtcaacagcgactatgaaacctacatgtccgctgatgacctgaggattaac
ctatggaactttgaaataaccaatcaaagttttaatattgtggacattaagccagccaac
atggaggagctcacggaggtgatcacagcagccgagttccacccccatcattgcaacacc
ttcgtgtacagcagcagcaaagggacaatccggctgtgtgacatgcgggcatctgccctg
tgtgacaggcacaccaaattttttgaagagccggaagatccaagcaacagatcatttttc
tctgaaattatctcttcgatttcggatgtgaagttcagccacagtgggaggtatatcatg
accagggactacttgaccgtcaaagtctgggatctcaacatggaaaaccgccccatcgag
acttaccaggttcatgactacctccgcagcaagctgtgttccctctatgaaaatgactgc
atttttgataaatttgagtgtgtgtggaatgggtcagacagtgtcatcatgacaggctcc
tacaacaacttcttcaggatgttcgacagaaacaccaagcgtgatgtgacccttgaggct
tcgagggaaaacagcaagccccgggctatcctcaaaccccgaaaagtgtgtgtggggggc
aagcggagaaaagacgagatcagtgtcgacagtctggactttagcaaaaagatcttgcat
acagcttggcatccttcagaaaatattatagcagtggcggctacaaataacctatatata
ttccaggacaaggttaactag

DBGET integrated database retrieval system