KEGG   Homo sapiens (human): 5522Help
Entry
5522              CDS       T01001                                 

Gene name
PPP2R2C, B55-GAMMA, IMYPNO, IMYPNO1, PR52, PR55G
Definition
protein phosphatase 2, regulatory subunit B, gamma (EC:3.1.3.16)
Orthology
K04354  
serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
Hippo signaling pathway
Tight junction
Dopaminergic synapse
Chagas disease (American trypanosomiasis)
Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    5522 (PPP2R2C)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    5522 (PPP2R2C)
   04151 PI3K-Akt signaling pathway
    5522 (PPP2R2C)
   04152 AMPK signaling pathway
    5522 (PPP2R2C)
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    5522 (PPP2R2C)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5522 (PPP2R2C)
  Nervous system
   04728 Dopaminergic synapse
    5522 (PPP2R2C)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    5522 (PPP2R2C)
   05142 Chagas disease (American trypanosomiasis)
    5522 (PPP2R2C)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5522 (PPP2R2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p16.1
AA seq 440 aa AA seqDB search
MREADTLRPPQLMEVSADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEY
DVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKITERDKRP
EGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSISVNSDCET
YMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVYSSSKGSL
RLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRDYLTVKVW
DLNMEARPIETYQVHDYLRSKLCSLYENDCIFDKFECAWNGSDSVIMTGAYNNFFRMFDR
NTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAWHPAENII
AIAATNNLYIFQDKVNSDMH
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaggcggacacgttgaggccacctcagctgatggaagtttccgctgacatcatc
tctaccgttgagttcaaccacacgggagagctgctggccacaggtgacaagggcggccgg
gtcgtcatcttccagcgggaaccagagagtaaaaatgcgccccacagccagggcgaatac
gacgtgtacagcactttccagagccacgagccggagtttgactatctcaagagcctggag
atagaggagaagatcaacaagatcaagtggctcccacagcagaacgccgcccactcactc
ctgtccaccaacgataaaactatcaaattatggaagattaccgaacgagataaaaggccc
gaaggatacaacctgaaggatgaagaggggaaacttaaggacctgtccacggtgacgtca
ctgcaggtgccagtgctgaagcccatggatctgatggtggaggtgagccctcggaggatc
tttgccaatggccacacctaccacatcaactccatctccgtcaacagtgactgcgagacc
tacatgtcggcggatgacctgcgcatcaacctctggcacctggccatcaccgacaggagc
ttcaacatcgtggacatcaagccggccaacatggaggaccttacggaggtgatcacagca
tctgagttccatccgcaccactgcaacctcttcgtctacagcagcagcaagggctccctg
cggctctgcgacatgcgggcagctgccctgtgtgacaagcattccaagctctttgaagag
cctgaggaccccagtaaccgctcattcttctcggaaatcatctcctccgtgtccgacgtg
aagttcagccacagcggccgctacatgctcacccgggactaccttacagtcaaggtctgg
gacctgaacatggaggcaagacccatagagacctaccaggtccatgactaccttcggagc
aagctctgttccctgtacgagaacgactgcattttcgacaagtttgaatgtgcctggaac
gggagcgacagcgtcatcatgaccggggcctacaacaacttcttccgcatgttcgatcgg
aacaccaagcgggacgtgaccctggaggcctcgagggaaagcagcaagccccgggctgtg
ctcaagccacggcgcgtgtgcgtggggggcaagcgccggcgtgatgacatcagtgtggac
agcttggacttcaccaagaagatcctgcacacggcctggcacccggctgagaacatcatt
gccatcgccgccaccaacaacctgtacatcttccaggacaaggtaaactctgacatgcac
tag

DBGET integrated database retrieval system