KEGG   Homo sapiens (human): 5522Help
Entry
5522              CDS       T01001                                 

Gene name
PPP2R2C, B55-GAMMA, IMYPNO, IMYPNO1, PR52, PR55G
Definition
protein phosphatase 2, regulatory subunit B, gamma (EC:3.1.3.16)
Orthology
K04354  
serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Hippo signaling pathway
Tight junction
Dopaminergic synapse
Chagas disease (American trypanosomiasis)
Hepatitis C
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:hsa03015]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p16.1
AA seq 440 aa AA seqDB search
MREADTLRPPQLMEVSADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEY
DVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKITERDKRP
EGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSISVNSDCET
YMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVYSSSKGSL
RLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRDYLTVKVW
DLNMEARPIETYQVHDYLRSKLCSLYENDCIFDKFECAWNGSDSVIMTGAYNNFFRMFDR
NTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAWHPAENII
AIAATNNLYIFQDKVNSDMH
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaggcggacacgttgaggccacctcagctgatggaagtttccgctgacatcatc
tctaccgttgagttcaaccacacgggagagctgctggccacaggtgacaagggcggccgg
gtcgtcatcttccagcgggaaccagagagtaaaaatgcgccccacagccagggcgaatac
gacgtgtacagcactttccagagccacgagccggagtttgactatctcaagagcctggag
atagaggagaagatcaacaagatcaagtggctcccacagcagaacgccgcccactcactc
ctgtccaccaacgataaaactatcaaattatggaagattaccgaacgagataaaaggccc
gaaggatacaacctgaaggatgaagaggggaaacttaaggacctgtccacggtgacgtca
ctgcaggtgccagtgctgaagcccatggatctgatggtggaggtgagccctcggaggatc
tttgccaatggccacacctaccacatcaactccatctccgtcaacagtgactgcgagacc
tacatgtcggcggatgacctgcgcatcaacctctggcacctggccatcaccgacaggagc
ttcaacatcgtggacatcaagccggccaacatggaggaccttacggaggtgatcacagca
tctgagttccatccgcaccactgcaacctcttcgtctacagcagcagcaagggctccctg
cggctctgcgacatgcgggcagctgccctgtgtgacaagcattccaagctctttgaagag
cctgaggaccccagtaaccgctcattcttctcggaaatcatctcctccgtgtccgacgtg
aagttcagccacagcggccgctacatgctcacccgggactaccttacagtcaaggtctgg
gacctgaacatggaggcaagacccatagagacctaccaggtccatgactaccttcggagc
aagctctgttccctgtacgagaacgactgcattttcgacaagtttgaatgtgcctggaac
gggagcgacagcgtcatcatgaccggggcctacaacaacttcttccgcatgttcgatcgg
aacaccaagcgggacgtgaccctggaggcctcgagggaaagcagcaagccccgggctgtg
ctcaagccacggcgcgtgtgcgtggggggcaagcgccggcgtgatgacatcagtgtggac
agcttggacttcaccaagaagatcctgcacacggcctggcacccggctgagaacatcatt
gccatcgccgccaccaacaacctgtacatcttccaggacaaggtaaactctgacatgcac
tag

DBGET integrated database retrieval system