KEGG   Homo sapiens (human): 5527Help
Entry
5527              CDS       T01001                                 

Gene name
PPP2R5C, B56G, PR61G
Definition
(RefSeq) protein phosphatase 2 regulatory subunit B'gamma
  KO
K11584  
serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Sphingolipid signaling pathway
Oocyte meiosis
PI3K-Akt signaling pathway
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    5527 (PPP2R5C)
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    5527 (PPP2R5C)
   04151 PI3K-Akt signaling pathway
    5527 (PPP2R5C)
   04152 AMPK signaling pathway
    5527 (PPP2R5C)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    5527 (PPP2R5C)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5527 (PPP2R5C)
  Nervous system
   04728 Dopaminergic synapse
    5527 (PPP2R5C)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5527 (PPP2R5C)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5527 (PPP2R5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q32.31
AA seq 524 aa AA seqDB search
MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPL
SDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDP
EEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERD
FLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLK
EEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPK
EVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLIS
DNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEK
LKMKEREEAWVKIENLAKANPQYTVYSQASTMSIPVAMETDGPLFEDVQMLRKTVKDEAH
QAQKDPKKDRPLARRKSELPQDPHTKKALEAHCRADELASQDGR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgttgacatgtaataaagcgggcagcaggatggtggtggatgcggccaactccaatggg
cctttccagcccgtggtccttctccatattcgagatgttcctcctgctgatcaagagaag
ctttttatccagaagttacgtcagtgttgcgtcctctttgactttgtttctgatccacta
agtgacctaaagtggaaggaagtaaaacgagctgctttaagtgaaatggtagaatatatc
acccataatcggaatgtgatcacagagcctatttacccagaagtagtccatatgtttgca
gttaacatgtttcgaacattaccaccttcctccaatcctacgggagcggaatttgacccg
gaggaagatgaaccaacgttagaagcagcctggcctcatctacagcttgtttatgaattt
ttcttaagatttttagagtctccagatttccaacctaatatagcgaagaaatatattgat
cagaagtttgtattgcagcttttagagctctttgacagtgaagatcctcgggagagagat
tttcttaaaaccacccttcacagaatctatgggaaattcctaggcttgagagcttacatc
agaaaacagataaataatatattttataggtttatttatgaaacagagcatcataatggc
atagcagagttactggaaatattgggaagtataattaatggatttgccttaccactaaaa
gaagagcacaagattttcttattgaaggtgttactacctttgcacaaagtgaaatctctg
agtgtctaccatccccagctggcatactgtgtagtgcagtttttagaaaaggacagcacc
ctcacggaaccagtggtgatggcacttctcaaatactggccaaagactcacagtccaaaa
gaagtaatgttcttaaacgaattagaagagattttagatgtcattgaaccatcagaattt
gtgaagatcatggaacccctcttccggcagttggccaaatgtgtctccagcccacacttc
caggtggcagagcgagctctctattactggaataatgaatacatcatgagtttaatcagt
gacaacgcagcgaagattctgcccatcatgtttccttccttgtaccgcaactcaaagacc
cattggaacaagacaatacatggcttgatatacaacgccctgaagctcttcatggagatg
aaccaaaagctatttgatgactgtacacaacagttcaaagcagagaaactaaaagagaag
ctaaaaatgaaagaacgggaagaagcatgggttaaaatagaaaatctagccaaagccaat
ccccagtacacagtgtatagtcaagccagcaccatgagcattccggttgcaatggagaca
gatgggcctttatttgaagatgtgcagatgctgagaaagacagtgaaggacgaggctcat
caggcacagaaagatccgaagaaggaccgtcctcttgcacgccgcaagtccgagctgcct
caggacccccacaccaagaaagccttggaagctcactgcagggccgatgagctggcctcc
caggacggccgctag

DBGET integrated database retrieval system