KEGG   Homo sapiens (human): 5528Help
Entry
5528              CDS       T01001                                 

Gene name
PPP2R5D, B56D, MRD35
Definition
(RefSeq) protein phosphatase 2 regulatory subunit B'delta
  KO
K11584  
serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Sphingolipid signaling pathway
Oocyte meiosis
PI3K-Akt signaling pathway
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    5528 (PPP2R5D)
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    5528 (PPP2R5D)
   04151 PI3K-Akt signaling pathway
    5528 (PPP2R5D)
   04152 AMPK signaling pathway
    5528 (PPP2R5D)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    5528 (PPP2R5D)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5528 (PPP2R5D)
  Nervous system
   04728 Dopaminergic synapse
    5528 (PPP2R5D)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5528 (PPP2R5D)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5528 (PPP2R5D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.1
AA seq 602 aa AA seqDB search
MPYKLKKEKEPPKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQSQPPSSNKRPS
NSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQ
KLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLF
RTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFV
LALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAEL
LEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEP
VIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAE
RALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKL
FDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPT
AEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQE
AL
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgccctataaactgaaaaaggagaaggagccccccaaggttgccaaatgcacagccaag
cctagcagctcgggcaaggatggtggaggcgagaacactgaggaggcccagccgcagccc
cagccccagccccagccccaagcccagtctcagccaccgtcatccaacaagcgtcccagc
aatagcacgccgccccccacgcagctcagcaaaatcaagtactcaggggggccccagatt
gtcaagaaggagcgacggcaaagctcctcccgcttcaacctcagcaagaatcgggagctg
cagaagcttcctgccctgaaagattcgccaacccaggagcgggaggagctgtttatccag
aagctacgccagtgctgtgtcctctttgacttcgtgtcagacccactcagtgacctcaaa
ttcaaggaggtgaagcgggcaggactcaacgagatggtggagtacatcacccatagccgt
gatgttgtcactgaggccatttaccctgaggctgtcaccatgttttcagtgaacctcttc
cggacgctgccaccttcatcgaatcccacaggggctgagtttgacccagaggaagatgag
cccaccctggaagctgcttggccacatctccagctcgtgtatgagttcttcttacgtttc
cttgagtctcctgatttccagccaaacatagccaagaagtacatcgaccagaagtttgta
cttgctctcctagacctatttgacagtgaggatcctcgagagcgggacttcctcaagacc
attttgcatcgcatctatggcaagtttttggggctccgggcttatatccgtaggcagatc
aaccacatcttctacaggttcatctacgagacggagcatcacaacgggattgctgagctc
ctggagatcctgggcagcatcatcaatggctttgccctgccccttaaagaagagcacaag
atgttcctcatccgtgtcctacttccccttcacaaggtcaagtccctgagtgtctaccac
cctcagctggcatactgtgtggtacaattcctggagaaggagagcagtctgactgagccg
gtaattgtgggacttctcaagttttggcccaagacccacagccccaaggaggtgatgttc
ttgaatgagctggaggagattctggacgtcattgaaccttctgagttcagcaaagtgatg
gaacccctcttccgccagctggccaagtgtgtctctagcccccatttccaggtggcagag
cgtgctctctattactggaacaatgagtacatcatgagcctgataagtgacaatgctgcc
cgagtcctccccatcatgttccctgcactctacaggaactccaagagccactggaacaag
acaatccatggactgatctataatgccctgaagttgtttatggaaatgaatcagaagctg
tttgatgactgcacacaacaatacaaggcagagaagcagaagggccggttccgaatgaag
gaaagggaagagatgtggcaaaaaatcgaggagctggcccggcttaatccccagtatccc
atgttccgagcccctccaccactgccccctgtgtactcgatggagacagagacccccaca
gctgaggacatccagcttctgaagaggactgtggagactgaggctgttcagatgctaaaa
gacatcaagaaggagaaagtgctgctgcggaggaagtcggagctgccccaggacgtgtac
accatcaaggcactggaggcgcacaagcgggcggaagagttcctaactgccagccaggag
gctctctga

DBGET integrated database retrieval system