KEGG   Homo sapiens (human): 553Help
Entry
553               CDS       T01001                                 

Gene name
AVPR1B, AVPR3
Definition
(RefSeq) arginine vasopressin receptor 1B
  KO
K04227  
arginine vasopressin receptor 1B
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Vascular smooth muscle contraction
Drug target
Vasopressin: 
Desmopressin: 
Lypressin: 
Terlipressin: 
Ornipressin: 
Argipressin: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    553 (AVPR1B)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    553 (AVPR1B)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    553 (AVPR1B)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Pituitary hormone
   Vasopressin
    553 (AVPR1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1q32
AA seq 424 aa AA seqDB search
MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLG
QLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFA
STYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQG
SGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVG
GGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSV
QMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQ
PRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAE
TIIF
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggattctgggcctctgtgggatgccaaccccacccctcggggcaccctctctgccccc
aatgccacaacaccctggctgggccgggatgaggagctggccaaggtggagatcggagtc
ctggccactgtcctggtgctggcgaccgggggcaacctggctgtgctgctgaccctgggc
cagctgggccgcaagcgctcccgcatgcacctgttcgtgctgcacttagccctgacagac
ctggccgtggcgctcttccaggtgctgccacagctgctgtgggacatcacctaccgcttc
cagggccccgacctcctgtgcagggccgtcaagtacctgcaggtgctcagcatgtttgcc
tccacctacatgctgctggccatgacgctggaccgctacctggctgtctgtcaccccctg
cgcagcctccagcagccaggccagtccacctacctgctcatcgctgctccctggctgctg
gccgccatcttcagcctccctcaagtcttcattttttccctgcgggaggtgatccagggc
tcaggggtgctggactgctgggcagacttcggcttcccttgggggccacgggcctacctc
acctggaccaccctggctatcttcgttctgccggtgaccatgctcacggcctgctacagc
ctcatctgccatgagatctgtaaaaacctaaaagtcaagacacaggcctggcgggtggga
ggagggggctggaggacttgggacaggccctcaccttccaccttagctgccaccactcgg
gggctgccatctcgggtcagcagcatcaacaccatctcacgggccaagatccgaacagtg
aagatgacctttgtcatcgtgctggcctacatcgcttgctgggctcccttcttcagtgtc
cagatgtggtccgtgtgggacaagaatgcccctgatgaagattccaccaatgtggctttc
accatctctatgcttttgggcaacctcaacagctgctgcaacccctggatctacatgggc
ttcaacagccacctgttaccgcggcccctgcgtcaccttgcctgctgtgggggtccccag
cccaggatgcgccggcggctctccgacggcagcctctcgagccgccacaccacgctgctg
acccgctccagctgcccggccaccctcagcctcagcctcagcctaaccctcagtgggagg
cccaggcctgaagagtcaccaagggacttggagctggcagatggggaaggcaccgctgag
accatcatcttttag

DBGET integrated database retrieval system