KEGG   Homo sapiens (human): 553Help
Entry
553               CDS       T01001                                 

Gene name
AVPR1B, AVPR3, V1bR
Definition
(RefSeq) arginine vasopressin receptor 1B
  KO
K04227  arginine vasopressin receptor 1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
Drug target
Lypressin: D00366
Ornipressin: D07227
Terlipressin (DG00498): D06672 D08571
Vasopressin (Argipressin) (DG00496): D00101 D02983 D09820
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    553 (AVPR1B)
   04072 Phospholipase D signaling pathway
    553 (AVPR1B)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    553 (AVPR1B)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    553 (AVPR1B)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Pituitary hormone
   Vasopressin
    553 (AVPR1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 DUF1856 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srv Srg
Motif
Other DBs
NCBI-GeneID: 553
NCBI-ProteinID: NP_000698
OMIM: 600264
HGNC: 896
Ensembl: ENSG00000198049
Vega: OTTHUMG00000184377
Pharos: P47901(Tclin)
UniProt: P47901
Position
1q32.1
AA seq 424 aa AA seqDB search
MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLG
QLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFA
STYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQG
SGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVG
GGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSV
QMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQ
PRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAE
TIIF
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggattctgggcctctgtgggatgccaaccccacccctcggggcaccctctctgccccc
aatgccacaacaccctggctgggccgggatgaggagctggccaaggtggagatcggagtc
ctggccactgtcctggtgctggcgaccgggggcaacctggctgtgctgctgaccctgggc
cagctgggccgcaagcgctcccgcatgcacctgttcgtgctgcacttagccctgacagac
ctggccgtggcgctcttccaggtgctgccacagctgctgtgggacatcacctaccgcttc
cagggccccgacctcctgtgcagggccgtcaagtacctgcaggtgctcagcatgtttgcc
tccacctacatgctgctggccatgacgctggaccgctacctggctgtctgtcaccccctg
cgcagcctccagcagccaggccagtccacctacctgctcatcgctgctccctggctgctg
gccgccatcttcagcctccctcaagtcttcattttttccctgcgggaggtgatccagggc
tcaggggtgctggactgctgggcagacttcggcttcccttgggggccacgggcctacctc
acctggaccaccctggctatcttcgttctgccggtgaccatgctcacggcctgctacagc
ctcatctgccatgagatctgtaaaaacctaaaagtcaagacacaggcctggcgggtggga
ggagggggctggaggacttgggacaggccctcaccttccaccttagctgccaccactcgg
gggctgccatctcgggtcagcagcatcaacaccatctcacgggccaagatccgaacagtg
aagatgacctttgtcatcgtgctggcctacatcgcttgctgggctcccttcttcagtgtc
cagatgtggtccgtgtgggacaagaatgcccctgatgaagattccaccaatgtggctttc
accatctctatgcttttgggcaacctcaacagctgctgcaacccctggatctacatgggc
ttcaacagccacctgttaccgcggcccctgcgtcaccttgcctgctgtgggggtccccag
cccaggatgcgccggcggctctccgacggcagcctctcgagccgccacaccacgctgctg
acccgctccagctgcccggccaccctcagcctcagcctcagcctaaccctcagtgggagg
cccaggcctgaagagtcaccaagggacttggagctggcagatggggaaggcaccgctgag
accatcatcttttag

DBGET integrated database retrieval system