KEGG   Homo sapiens (human): 5532Help
Entry
5532              CDS       T01001                                 

Gene name
PPP3CB, CALNA2, CALNB, CNA2, PP2Bbeta
Definition
protein phosphatase 3, catalytic subunit, beta isozyme (EC:3.1.3.16)
Orthology
K04348  
serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Oocyte meiosis
Apoptosis
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Long-term potentiation
Glutamatergic synapse
Dopaminergic synapse
Oxytocin signaling pathway
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Amphetamine addiction
Tuberculosis
HTLV-I infection
Drug target
Tacrolimus: 
Pimecrolimus: 
Ciclosporin: 
Tacrolimus: 
Voclosporin: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    5532 (PPP3CB)
   04310 Wnt signaling pathway
    5532 (PPP3CB)
   04370 VEGF signaling pathway
    5532 (PPP3CB)
   04020 Calcium signaling pathway
    5532 (PPP3CB)
   04022 cGMP - PKG signaling pathway
    5532 (PPP3CB)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    5532 (PPP3CB)
   04210 Apoptosis
    5532 (PPP3CB)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5532 (PPP3CB)
   04660 T cell receptor signaling pathway
    5532 (PPP3CB)
   04662 B cell receptor signaling pathway
    5532 (PPP3CB)
  Endocrine system
   04921 Oxytocin signaling pathway
    5532 (PPP3CB)
  Nervous system
   04724 Glutamatergic synapse
    5532 (PPP3CB)
   04728 Dopaminergic synapse
    5532 (PPP3CB)
   04720 Long-term potentiation
    5532 (PPP3CB)
  Development
   04360 Axon guidance
    5532 (PPP3CB)
   04380 Osteoclast differentiation
    5532 (PPP3CB)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    5532 (PPP3CB)
   05014 Amyotrophic lateral sclerosis (ALS)
    5532 (PPP3CB)
  Substance dependence
   05031 Amphetamine addiction
    5532 (PPP3CB)
  Infectious diseases
   05152 Tuberculosis
    5532 (PPP3CB)
   05166 HTLV-I infection
    5532 (PPP3CB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5532 (PPP3CB)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     5532 (PPP3CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q22.2
AA seq 525 aa AA seqDB search
MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANT
RYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYS
ERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLL
WSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMY
RKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFT
WSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEIIRNKIRAIGKMARVF
SVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSF
EEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggccgccccggagccggcccgggctgcaccgcccccacccccgcccccgccgccccct
cccggggctgaccgcgtcgtcaaagctgtccctttccccccaacacatcgcttgacatct
gaagaagtatttgatttggatgggatacccagggttgatgttctgaagaaccacttggtg
aaagaaggtcgagtagatgaagaaattgcgcttagaattatcaatgagggtgctgccatc
cttcggagagagaaaaccatgatagaagtagaagctccaatcacagtgtgtggtgacatc
catggccaattttttgatctgatgaaactttttgaagtaggaggatcacctgctaataca
cgatacctttttcttggcgattatgtggacagaggttattttagtatagagtgtgtctta
tatttatgggttctgaagattctatacccaagcacattatttcttctgagaggcaaccat
gaatgcagacaccttactgaatattttacctttaagcaggaatgtaaaattaagtattcg
gaaagagtctatgaagcttgtatggaagcttttgatagtttgcctcttgctgcactttta
aaccaacagtttctttgtgttcatggtggactttcaccagaaatacacacactggatgat
attaggagattagatagattcaaagagccacctgcatttggaccaatgtgtgacttgtta
tggtccgatccttctgaagattttggaaatgaaaaatcacaggaacattttagtcacaat
acagttcgaggatgttcttatttttataactatccagcagtgtgtgaatttttgcaaaac
aataatttgttatcgattattagagctcatgaagctcaagatgcaggctatagaatgtac
agaaaaagtcaaactacagggttcccttcattaataacaattttttcggcacctaattac
ttagatgtctacaataataaagctgctgtattaaagtatgaaaataatgtgatgaatatt
cgacagtttaactgttctccacatccttactggttgcctaattttatggatgtcttcacg
tggtctttaccgtttgttggagaaaaagtgacagaaatgttggtaaatgttctgagtatt
tgctctgatgatgaactaatgactgaaggtgaagaccagtttgatgtaggttcagctgca
gcccggaaagaaatcataagaaacaaaattcgagcaattggcaagatggcaagagtcttc
tctgttctcagggaggagagtgaaagtgtgctgacactcaagggcctgactcccacaggg
atgttgcctagtggagtgttagctggaggacggcagaccctgcaaagtgccacagttgag
gctattgaggctgaaaaagcaatacgaggattctctccaccacatagaatctgcagtttt
gaagaggcaaagggtttggataggatcaatgagagaatgccacctcggaaagatgctgta
cagcaagatggtttcaattctctgaacaccgcacatgccactgagaaccacgggacgggc
aaccatactgcccagtga

DBGET integrated database retrieval system