KEGG   Homo sapiens (human): 5534Help
Entry
5534              CDS       T01001                                 

Gene name
PPP3R1, CALNB1, CNB, CNB1
Definition
protein phosphatase 3, regulatory subunit B, alpha (EC:3.1.3.16)
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Oocyte meiosis
Apoptosis
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Long-term potentiation
Glutamatergic synapse
Oxytocin signaling pathway
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Amphetamine addiction
Tuberculosis
HTLV-I infection
Drug target
Tacrolimus: 
Pimecrolimus: 
Ciclosporin: 
Tacrolimus: 
Voclosporin: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    5534 (PPP3R1)
   04310 Wnt signaling pathway
    5534 (PPP3R1)
   04370 VEGF signaling pathway
    5534 (PPP3R1)
   04020 Calcium signaling pathway
    5534 (PPP3R1)
   04022 cGMP - PKG signaling pathway
    5534 (PPP3R1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    5534 (PPP3R1)
   04210 Apoptosis
    5534 (PPP3R1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5534 (PPP3R1)
   04660 T cell receptor signaling pathway
    5534 (PPP3R1)
   04662 B cell receptor signaling pathway
    5534 (PPP3R1)
  Endocrine system
   04921 Oxytocin signaling pathway
    5534 (PPP3R1)
  Nervous system
   04724 Glutamatergic synapse
    5534 (PPP3R1)
   04720 Long-term potentiation
    5534 (PPP3R1)
  Development
   04360 Axon guidance
    5534 (PPP3R1)
   04380 Osteoclast differentiation
    5534 (PPP3R1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    5534 (PPP3R1)
   05014 Amyotrophic lateral sclerosis (ALS)
    5534 (PPP3R1)
  Substance dependence
   05031 Amphetamine addiction
    5534 (PPP3R1)
  Infectious diseases
   05152 Tuberculosis
    5534 (PPP3R1)
   05166 HTLV-I infection
    5534 (PPP3R1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     5534 (PPP3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p15
AA seq 170 aa AA seqDB search
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgcggatgaaatt
aaaaggctaggaaagagatttaagaagcttgatttggacaattctggttctttgagtgtg
gaagagttcatgtctctgcctgagttacaacagaatcctttagtacagcgagtaatagat
atattcgacacagatgggaatggagaagtagactttaaagaattcattgagggcgtctct
cagttcagtgtcaaaggagataaggagcagaaattgaggtttgctttccgtatctatgac
atggataaagatggctatatttccaatggggaactcttccaggtattgaagatgatggtg
gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca
gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta
gatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system