KEGG   Homo sapiens (human): 554Help
Entry
554               CDS       T01001                                 

Gene name
AVPR2, ADHR, DI1, DIR, DIR3, NDI, V2R
Definition
(RefSeq) arginine vasopressin receptor 2
  KO
K04228  
arginine vasopressin receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
Vasopressin-regulated water reabsorption
Disease
H00252  
Congenital nephrogenic diabetes insipidus (NDI)
H01294  
Nephrogenic syndrome of inappropriate antidiuresis (NSIAD)
Drug target
Argipressin: 
Conivaptan (DG00276): 
Desmopressin (DG00497): 
Lixivaptan: 
Lypressin: 
Mozavaptane hydrochloride: 
Ornipressin: 
Terlipressin (DG00498): 
Tolvaptan: 
Vasopressin (DG00496): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04072 Phospholipase D signaling pathway
    554 (AVPR2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    554 (AVPR2)
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    554 (AVPR2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Pituitary hormone
   Vasopressin
    554 (AVPR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 371 aa AA seqDB search
MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLA
ALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQ
RNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGP
SERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEA
PLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTT
ASSSLAKDTSS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgctcatggcgtccaccacttccgctgtgcctgggcatccctctctgcccagcctgccc
agcaacagcagccaggagaggccactggacacccgggacccgctgctagcccgggcggag
ctggcgctgctctccatagtctttgtggctgtggccctgagcaatggcctggtgctggcg
gccctagctcggcggggccggcggggccactgggcacccatacacgtcttcattggccac
ttgtgcctggccgacctggccgtggctctgttccaagtgctgccccagctggcctggaag
gccaccgaccgcttccgtgggccagatgccctgtgtcgggccgtgaagtatctgcagatg
gtgggcatgtatgcctcctcctacatgatcctggccatgacgctggaccgccaccgtgcc
atctgccgtcccatgctggcgtaccgccatggaagtggggctcactggaaccggccggtg
ctagtggcttgggccttctcgctccttctcagcctgccccagctcttcatcttcgcccag
cgcaacgtggaaggtggcagcggggtcactgactgctgggcctgctttgcggagccctgg
ggccgtcgcacctatgtcacctggattgccctgatggtgttcgtggcacctaccctgggt
atcgccgcctgccaggtgctcatcttccgggagattcatgccagtctggtgccagggcca
tcagagaggcctggggggcgccgcaggggacgccggacaggcagccccggtgagggagcc
cacgtgtcagcagctgtggccaagactgtgaggatgacgctagtgattgtggtcgtctat
gtgctgtgctgggcacccttcttcctggtgcagctgtgggccgcgtgggacccggaggca
cctctggaaggggcgccctttgtgctactcatgttgctggccagcctcaacagctgcacc
aacccctggatctatgcatctttcagcagcagcgtgtcctcagagctgcgaagcttgctc
tgctgtgcccggggacgcaccccacccagcctgggtccccaagatgagtcctgcaccacc
gccagctcctccctggccaaggacacttcatcgtga

DBGET integrated database retrieval system