KEGG   Homo sapiens (human): 554Help
Entry
554               CDS       T01001                                 

Gene name
AVPR2, ADHR, DI1, DIR, DIR3, NDI, V2R
Definition
(RefSeq) arginine vasopressin receptor 2
  KO
K04228  arginine vasopressin receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04962  Vasopressin-regulated water reabsorption
Disease
H00252  Congenital nephrogenic diabetes insipidus (NDI)
H01294  Nephrogenic syndrome of inappropriate antidiuresis (NSIAD)
H01682  Syndrome of inappropriate secretion of antidiuretic hormone (SIADH)
H01683  Disorders of antidiuretic hormone (ADH) secretion
Drug target
Conivaptan (DG00276): D01236 D07748
Desmopressin (DG00497): D00291 D02235
Lixivaptan: D04752
Lypressin: D00366
Mozavaptane hydrochloride: D01855
Ornipressin: D07227
Terlipressin (DG00498): D06672 D08571
Tolvaptan: D01213
Vasopressin (Argipressin) (DG00496): D00101 D02983 D09820
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04072 Phospholipase D signaling pathway
    554 (AVPR2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    554 (AVPR2)
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    554 (AVPR2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Pituitary hormone
   Vasopressin
    554 (AVPR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4 Git3
Motif
Other DBs
NCBI-GeneID: 554
NCBI-ProteinID: NP_000045
OMIM: 300538
HGNC: 897
Ensembl: ENSG00000126895
Vega: OTTHUMG00000024227
Pharos: P30518(Tclin)
UniProt: P30518
Position
Xq28
AA seq 371 aa AA seqDB search
MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLA
ALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQ
RNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGP
SERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEA
PLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTT
ASSSLAKDTSS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgctcatggcgtccaccacttccgctgtgcctgggcatccctctctgcccagcctgccc
agcaacagcagccaggagaggccactggacacccgggacccgctgctagcccgggcggag
ctggcgctgctctccatagtctttgtggctgtggccctgagcaatggcctggtgctggcg
gccctagctcggcggggccggcggggccactgggcacccatacacgtcttcattggccac
ttgtgcctggccgacctggccgtggctctgttccaagtgctgccccagctggcctggaag
gccaccgaccgcttccgtgggccagatgccctgtgtcgggccgtgaagtatctgcagatg
gtgggcatgtatgcctcctcctacatgatcctggccatgacgctggaccgccaccgtgcc
atctgccgtcccatgctggcgtaccgccatggaagtggggctcactggaaccggccggtg
ctagtggcttgggccttctcgctccttctcagcctgccccagctcttcatcttcgcccag
cgcaacgtggaaggtggcagcggggtcactgactgctgggcctgctttgcggagccctgg
ggccgtcgcacctatgtcacctggattgccctgatggtgttcgtggcacctaccctgggt
atcgccgcctgccaggtgctcatcttccgggagattcatgccagtctggtgccagggcca
tcagagaggcctggggggcgccgcaggggacgccggacaggcagccccggtgagggagcc
cacgtgtcagcagctgtggccaagactgtgaggatgacgctagtgattgtggtcgtctat
gtgctgtgctgggcacccttcttcctggtgcagctgtgggccgcgtgggacccggaggca
cctctggaaggggcgccctttgtgctactcatgttgctggccagcctcaacagctgcacc
aacccctggatctatgcatctttcagcagcagcgtgtcctcagagctgcgaagcttgctc
tgctgtgcccggggacgcaccccacccagcctgggtccccaagatgagtcctgcaccacc
gccagctcctccctggccaaggacacttcatcgtga

DBGET integrated database retrieval system