KEGG   Homo sapiens (human): 554Help
Entry
554               CDS       T01001                                 

Gene name
AVPR2, ADHR, DI1, DIR, DIR3, NDI, V2R
Definition
arginine vasopressin receptor 2
Orthology
K04228  
arginine vasopressin receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Vasopressin-regulated water reabsorption
Disease
H00252  
Congenital nephrogenic diabetes insipidus (NDI)
H01294  
Nephrogenic syndrome of inappropriate antidiuresis (NSIAD)
Drug target
Tolvaptan: 
Conivaptan: 
Vasopressin: 
Desmopressin: 
Lypressin: 
Terlipressin: 
Ornipressin: 
Argipressin: 
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Excretory system; Vasopressin-regulated water reabsorption [PATH:hsa04962]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 371 aa AA seqDB search
MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLA
ALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQ
RNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGP
SERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEA
PLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTT
ASSSLAKDTSS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgctcatggcgtccaccacttccgctgtgcctgggcatccctctctgcccagcctgccc
agcaacagcagccaggagaggccactggacacccgggacccgctgctagcccgggcggag
ctggcgctgctctccatagtctttgtggctgtggccctgagcaatggcctggtgctggcg
gccctagctcggcggggccggcggggccactgggcacccatacacgtcttcattggccac
ttgtgcctggccgacctggccgtggctctgttccaagtgctgccccagctggcctggaag
gccaccgaccgcttccgtgggccagatgccctgtgtcgggccgtgaagtatctgcagatg
gtgggcatgtatgcctcctcctacatgatcctggccatgacgctggaccgccaccgtgcc
atctgccgtcccatgctggcgtaccgccatggaagtggggctcactggaaccggccggtg
ctagtggcttgggccttctcgctccttctcagcctgccccagctcttcatcttcgcccag
cgcaacgtggaaggtggcagcggggtcactgactgctgggcctgctttgcggagccctgg
ggccgtcgcacctatgtcacctggattgccctgatggtgttcgtggcacctaccctgggt
atcgccgcctgccaggtgctcatcttccgggagattcatgccagtctggtgccagggcca
tcagagaggcctggggggcgccgcaggggacgccggacaggcagccccggtgagggagcc
cacgtgtcagcagctgtggccaagactgtgaggatgacgctagtgattgtggtcgtctat
gtgctgtgctgggcacccttcttcctggtgcagctgtgggccgcgtgggacccggaggca
cctctggaaggggcgccctttgtgctactcatgttgctggccagcctcaacagctgcacc
aacccctggatctatgcatctttcagcagcagcgtgtcctcagagctgcgaagcttgctc
tgctgtgcccggggacgcaccccacccagcctgggtccccaagatgagtcctgcaccacc
gccagctcctccctggccaaggacacttcatcgtga

DBGET integrated database retrieval system