KEGG   Homo sapiens (human): 554313Help
Entry
554313            CDS       T01001                                 

Gene name
HIST2H4B, H4/o
Definition
(RefSeq) histone cluster 2 H4 family member b
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Network
N00271  HCV NS3 to host-cell-protein inhibition
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    554313 (HIST2H4B)
  Immune diseases
   05322 Systemic lupus erythematosus
    554313 (HIST2H4B)
  Substance dependence
   05034 Alcoholism
    554313 (HIST2H4B)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    554313 (HIST2H4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Motif
Other DBs
NCBI-GeneID: 554313
NCBI-ProteinID: NP_001029249
HGNC: 29607
Ensembl: ENSG00000270276
Vega: OTTHUMG00000188201
UniProt: P62805 B2R4R0
Structure
PDB: 

Jmol
Position
1q21.2
AA seq 103 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcagaggaaagggcggaaaaggcttaggcaaagggggcgctaagcgccaccgc
aaggtcttgagagacaacattcagggcatcaccaagcctgccattcggcgtctagctcgg
cgtggcggcgttaagcggatctctggcctcatttacgaggagacccgcggtgtgctgaag
gtgttcctggagaatgtgattcgggacgcagtcacctacaccgagcacgccaagcgcaag
accgtcacagccatggatgtggtgtacgcgctcaagcgccaggggcgcaccctgtacggc
ttcggaggctag

DBGET integrated database retrieval system