KEGG   Homo sapiens (human): 554313Help
Entry
554313            CDS       T01001                                 

Gene name
HIST2H4B, H4/o
Definition
histone cluster 2, H4b
Orthology
K11254  
histone H4
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    554313 (HIST2H4B)
  Immune diseases
   05322 Systemic lupus erythematosus
    554313 (HIST2H4B)
  Substance dependence
   05034 Alcoholism
    554313 (HIST2H4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21
AA seq 103 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcagaggaaagggcggaaaaggcttaggcaaagggggcgctaagcgccaccgc
aaggtcttgagagacaacattcagggcatcaccaagcctgccattcggcgtctagctcgg
cgtggcggcgttaagcggatctctggcctcatttacgaggagacccgcggtgtgctgaag
gtgttcctggagaatgtgattcgggacgcagtcacctacaccgagcacgccaagcgcaag
accgtcacagccatggatgtggtgtacgcgctcaagcgccaggggcgcaccctgtacggc
ttcggaggctag

DBGET integrated database retrieval system