KEGG   Homo sapiens (human): 55589Help
Entry
55589             CDS       T01001                                 

Gene name
BMP2K, BIKE
Definition
BMP2 inducible kinase (EC:2.7.11.1)
Orthology
K08854  
BMP2 inducible kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Class
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q21.21
AA seq 662 aa AA seqDB search
MKKFSRMPKSEGGSGGGAAGGGAGGAGAGAGCGSGGSSVGVRVFAVGRHQVTLEESLAEG
GFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSIS
DNVWEVLILMEYCRAGQVVNQMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRD
LKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGG
KPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSRNIHCLIRFMLEP
DPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIPSALPEPMTASEAAARKSQIKARITDT
IGPTETSIAPRQRPKANSATTATPSVLTIQSSATPVKVLAPGEFGNHRPKGALRPGNGPE
ILLGQGPPQQPPQQHRVLQQLQQGDWRLQQLHLQHRHPHQQQQQQQQQQQQQQQQQQQQQ
QQQQQQHHHHHHHHLLQDAYMQQYQHATQQQQMLQQQFLMHSVYQPQPSASQYPTMMPQY
QQAFFQQQMLAQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV
ADKEAIANFTNQKNISNPPDMSGWNPFGEDNFSKLTEEELLDREFDLLRSSKGHLKAYFA
SQ
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagttctctcggatgcccaagtcggagggcggcagcggcggcggagcggcgggt
ggcggggctggcggggccggggccggggccggctgcggctccggcggctcgtccgtgggg
gtccgggtgttcgcggtcggccgccaccaggtcaccctggaagagtcgctggccgaaggt
ggattctccacagttttcctcgtgcgtactcacggtggaatccgatgtgcattgaagcga
atgtatgtcaataacatgccagacctcaatgtttgtaaaagggaaattacaattatgaaa
gagctatctggtcacaaaaatattgtgggctatttggactgtgctgttaattcaattagt
gataatgtatgggaagtccttatcttaatggaatattgtcgagctggacaggtagtgaat
caaatgaataagaagctacagacgggttttacagaaccagaagtgttacagatattctgt
gatacctgtgaagctgttgcaaggttgcatcagtgtaagactccaataattcaccgggat
ctgaaggtagaaaatattttgttgaatgatggtgggaactatgtactttgtgactttggc
agtgccactaataaatttcttaatcctcaaaaagatggagttaatgtagtagaagaagaa
attaaaaagtatacaactctgtcatacagagcccctgaaatgatcaacctttatggaggg
aaacccatcaccaccaaggctgatatctgggcactgggatgtctactctataaactttgt
ttcttcactcttccttttggtgagagtcaggttgctatctgtgatggcaacttcaccatc
ccagacaattctcgttactcccgtaacatacattgcttaataaggttcatgcttgaacca
gatccggaacatagacctgatatatttcaagtgtcatattttgcatttaaatttgccaaa
aaggattgtccagtctccaacatcaataattcttctattccttcagctcttcctgaaccg
atgactgctagtgaagcagctgctaggaaaagccaaataaaagccagaataacagatacc
attggaccaacagaaacctcaattgcaccaagacaaagaccaaaggccaactctgctact
actgccactcccagtgtgctgaccattcaaagttcagcaacacctgttaaagtccttgct
cctggtgaattcggtaaccatagaccaaaaggggcactaagacctggaaatggccctgaa
attttattgggtcagggacctcctcagcagccgccacagcagcatagagtactccagcaa
ctacagcagggagattggagattacagcaactccatttacagcatcgtcatcctcaccag
cagcagcagcagcagcagcagcaacagcaacagcagcagcagcaacagcaacagcagcag
cagcagcagcagcagcagcaccaccaccaccaccaccaccacctacttcaagatgcttat
atgcagcagtatcaacatgcaacacagcagcaacagatgcttcaacaacaatttttaatg
cattcggtatatcaaccacaaccttctgcatcacagtatcctacaatgatgccgcagtat
cagcaggctttctttcaacagcagatgctagctcaacatcagccgtctcaacaacaggca
tcacctgaatatcttacctcccctcaagagttctcaccagccttagtttcctacacttca
tcacttccagctcaggttggaaccataatggactcctcctatagtgccaataggtcagtt
gctgataaagaggccattgcaaatttcacaaatcagaagaacatcagcaatccacctgat
atgtcagggtggaatccttttggagaggataatttctctaagttaacagaagaggaacta
ttggacagagaatttgaccttctaagatcaagtaagggacacttgaaggcttattttgct
tcacagtaa

DBGET integrated database retrieval system