KEGG   Homo sapiens (human): 55589Help
Entry
55589             CDS       T01001                                 

Gene name
BMP2K, BIKE
Definition
BMP2 inducible kinase (EC:2.7.11.1)
Orthology
K08854  
BMP2 inducible kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    55589 (BMP2K)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     55589 (BMP2K)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  NAK family [OT]
   55589 (BMP2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q21.21
AA seq 662 aa AA seqDB search
MKKFSRMPKSEGGSGGGAAGGGAGGAGAGAGCGSGGSSVGVRVFAVGRHQVTLEESLAEG
GFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSIS
DNVWEVLILMEYCRAGQVVNQMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRD
LKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGG
KPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSRNIHCLIRFMLEP
DPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIPSALPEPMTASEAAARKSQIKARITDT
IGPTETSIAPRQRPKANSATTATPSVLTIQSSATPVKVLAPGEFGNHRPKGALRPGNGPE
ILLGQGPPQQPPQQHRVLQQLQQGDWRLQQLHLQHRHPHQQQQQQQQQQQQQQQQQQQQQ
QQQQQQHHHHHHHHLLQDAYMQQYQHATQQQQMLQQQFLMHSVYQPQPSASQYPTMMPQY
QQAFFQQQMLAQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV
ADKEAIANFTNQKNISNPPDMSGWNPFGEDNFSKLTEEELLDREFDLLRSSKGHLKAYFA
SQ
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagttctctcggatgcccaagtcggagggcggcagcggcggcggagcggcgggt
ggcggggctggcggggccggggccggggccggctgcggctccggcggctcgtccgtgggg
gtccgggtgttcgcggtcggccgccaccaggtcaccctggaagagtcgctggccgaaggt
ggattctccacagttttcctcgtgcgtactcacggtggaatccgatgtgcattgaagcga
atgtatgtcaataacatgccagacctcaatgtttgtaaaagggaaattacaattatgaaa
gagctatctggtcacaaaaatattgtgggctatttggactgtgctgttaattcaattagt
gataatgtatgggaagtccttatcttaatggaatattgtcgagctggacaggtagtgaat
caaatgaataagaagctacagacgggttttacagaaccagaagtgttacagatattctgt
gatacctgtgaagctgttgcaaggttgcatcagtgtaagactccaataattcaccgggat
ctgaaggtagaaaatattttgttgaatgatggtgggaactatgtactttgtgactttggc
agtgccactaataaatttcttaatcctcaaaaagatggagttaatgtagtagaagaagaa
attaaaaagtatacaactctgtcatacagagcccctgaaatgatcaacctttatggaggg
aaacccatcaccaccaaggctgatatctgggcactgggatgtctactctataaactttgt
ttcttcactcttccttttggtgagagtcaggttgctatctgtgatggcaacttcaccatc
ccagacaattctcgttactcccgtaacatacattgcttaataaggttcatgcttgaacca
gatccggaacatagacctgatatatttcaagtgtcatattttgcatttaaatttgccaaa
aaggattgtccagtctccaacatcaataattcttctattccttcagctcttcctgaaccg
atgactgctagtgaagcagctgctaggaaaagccaaataaaagccagaataacagatacc
attggaccaacagaaacctcaattgcaccaagacaaagaccaaaggccaactctgctact
actgccactcccagtgtgctgaccattcaaagttcagcaacacctgttaaagtccttgct
cctggtgaattcggtaaccatagaccaaaaggggcactaagacctggaaatggccctgaa
attttattgggtcagggacctcctcagcagccgccacagcagcatagagtactccagcaa
ctacagcagggagattggagattacagcaactccatttacagcatcgtcatcctcaccag
cagcagcagcagcagcagcagcaacagcaacagcagcagcagcaacagcaacagcagcag
cagcagcagcagcagcagcaccaccaccaccaccaccaccacctacttcaagatgcttat
atgcagcagtatcaacatgcaacacagcagcaacagatgcttcaacaacaatttttaatg
cattcggtatatcaaccacaaccttctgcatcacagtatcctacaatgatgccgcagtat
cagcaggctttctttcaacagcagatgctagctcaacatcagccgtctcaacaacaggca
tcacctgaatatcttacctcccctcaagagttctcaccagccttagtttcctacacttca
tcacttccagctcaggttggaaccataatggactcctcctatagtgccaataggtcagtt
gctgataaagaggccattgcaaatttcacaaatcagaagaacatcagcaatccacctgat
atgtcagggtggaatccttttggagaggataatttctctaagttaacagaagaggaacta
ttggacagagaatttgaccttctaagatcaagtaagggacacttgaaggcttattttgct
tcacagtaa

DBGET integrated database retrieval system